FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6583, 117 aa
  1>>>pF1KE6583 117 - 117 aa - 117 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.0236+/-0.00046; mu= 13.9074+/- 0.028
 mean_var=75.0462+/-14.855, 0's: 0 Z-trim(117.5): 3  B-trim: 3 in 1/54
 Lambda= 0.148051
 statistics sampled from 18314 (18316) to 18314 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.862), E-opt: 0.2 (0.563), width:  16
 Scan time:  1.660

The best scores are:                                      opt bits E(32554)
CCDS12803.1 C19orf48 gene_id:84798|Hs108|chr19     ( 117)  839 186.5 3.2e-48


>>CCDS12803.1 C19orf48 gene_id:84798|Hs108|chr19          (117 aa)
 initn: 839 init1: 839 opt: 839  Z-score: 979.3  bits: 186.5 E(32554): 3.2e-48
Smith-Waterman score: 839; 100.0% identity (100.0% similar) in 117 aa overlap (1-117:1-117)

               10        20        30        40        50        60
pF1KE6 MTVLEAVLEIQAITGSRLLSMVPGPARPPGSCWDPTQCTRTWLLSHTPRRRWISGLPRAS
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS12 MTVLEAVLEIQAITGSRLLSMVPGPARPPGSCWDPTQCTRTWLLSHTPRRRWISGLPRAS
               10        20        30        40        50        60

               70        80        90       100       110       
pF1KE6 CRLGEEPPPLPYCDQAYGEELSIRHRETWAWLSRTDTAWPGAPGVKQARILGELLLV
       :::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS12 CRLGEEPPPLPYCDQAYGEELSIRHRETWAWLSRTDTAWPGAPGVKQARILGELLLV
               70        80        90       100       110       




117 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 14:35:06 2016 done: Tue Nov  8 14:35:06 2016
 Total Scan time:  1.660 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]