FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6546, 106 aa
  1>>>pF1KE6546 106 - 106 aa - 106 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.3835+/-0.000536; mu= 9.8491+/- 0.032
 mean_var=65.2229+/-13.183, 0's: 0 Z-trim(113.8): 5  B-trim: 0 in 0/53
 Lambda= 0.158809
 statistics sampled from 14409 (14411) to 14409 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.815), E-opt: 0.2 (0.443), width:  16
 Scan time:  1.120

The best scores are:                                      opt bits E(32554)
CCDS434.1 NDUFS5 gene_id:4725|Hs108|chr1           ( 106)  762 182.0 5.8e-47


>>CCDS434.1 NDUFS5 gene_id:4725|Hs108|chr1                (106 aa)
 initn: 762 init1: 762 opt: 762  Z-score: 956.6  bits: 182.0 E(32554): 5.8e-47
Smith-Waterman score: 762; 100.0% identity (100.0% similar) in 106 aa overlap (1-106:1-106)

               10        20        30        40        50        60
pF1KE6 MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEY
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS43 MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEY
               10        20        30        40        50        60

               70        80        90       100      
pF1KE6 DDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP
       ::::::::::::::::::::::::::::::::::::::::::::::
CCDS43 DDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP
               70        80        90       100      




106 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 14:17:31 2016 done: Tue Nov  8 14:17:31 2016
 Total Scan time:  1.120 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]