FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6540, 85 aa
  1>>>pF1KE6540 85 - 85 aa - 85 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.7850+/-0.000549; mu= 11.4394+/- 0.033
 mean_var=64.6632+/-12.862, 0's: 0 Z-trim(113.6): 37  B-trim: 0 in 0/51
 Lambda= 0.159494
 statistics sampled from 14159 (14196) to 14159 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.809), E-opt: 0.2 (0.436), width:  16
 Scan time:  1.260

The best scores are:                                      opt bits E(32554)
CCDS4289.1 SPINK7 gene_id:84651|Hs108|chr5         (  85)  594 144.0 1.1e-35


>>CCDS4289.1 SPINK7 gene_id:84651|Hs108|chr5              (85 aa)
 initn: 594 init1: 594 opt: 594  Z-score: 754.5  bits: 144.0 E(32554): 1.1e-35
Smith-Waterman score: 594; 100.0% identity (100.0% similar) in 85 aa overlap (1-85:1-85)

               10        20        30        40        50        60
pF1KE6 MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITY
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS42 MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITY
               10        20        30        40        50        60

               70        80     
pF1KE6 GNECHLCTESLKSNGRVQFLHDGSC
       :::::::::::::::::::::::::
CCDS42 GNECHLCTESLKSNGRVQFLHDGSC
               70        80     




85 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 14:14:23 2016 done: Tue Nov  8 14:14:23 2016
 Total Scan time:  1.260 Total Display time: -0.040

Function used was FASTA [36.3.4 Apr, 2011]