FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6534, 64 aa
  1>>>pF1KE6534 64 - 64 aa - 64 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.7823+/-0.000475; mu= 8.6110+/- 0.029
 mean_var=46.1747+/- 9.224, 0's: 0 Z-trim(114.8): 2  B-trim: 466 in 1/50
 Lambda= 0.188744
 statistics sampled from 15342 (15343) to 15342 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.855), E-opt: 0.2 (0.471), width:  16
 Scan time:  0.940

The best scores are:                                      opt bits E(32554)
CCDS10037.1 NOP10 gene_id:55505|Hs108|chr15        (  64)  444 127.1 7.5e-31


>>CCDS10037.1 NOP10 gene_id:55505|Hs108|chr15             (64 aa)
 initn: 444 init1: 444 opt: 444  Z-score: 667.3  bits: 127.1 E(32554): 7.5e-31
Smith-Waterman score: 444; 100.0% identity (100.0% similar) in 64 aa overlap (1-64:1-64)

               10        20        30        40        50        60
pF1KE6 MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQP
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS10 MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQP
               10        20        30        40        50        60

           
pF1KE6 RPVL
       ::::
CCDS10 RPVL
           




64 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 14:10:54 2016 done: Tue Nov  8 14:10:54 2016
 Total Scan time:  0.940 Total Display time: -0.010

Function used was FASTA [36.3.4 Apr, 2011]