FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6194, 69 aa
  1>>>pF1KE6194 69 - 69 aa - 69 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.5259+/-0.00043; mu= 10.9505+/- 0.026
 mean_var=48.3410+/- 9.638, 0's: 0 Z-trim(116.6): 4  B-trim: 0 in 0/52
 Lambda= 0.184466
 statistics sampled from 17224 (17227) to 17224 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.885), E-opt: 0.2 (0.529), width:  16
 Scan time:  1.130

The best scores are:                                      opt bits E(32554)
CCDS8054.1 COX8A gene_id:1351|Hs108|chr11          (  69)  457 127.6 6.1e-31


>>CCDS8054.1 COX8A gene_id:1351|Hs108|chr11               (69 aa)
 initn: 457 init1: 457 opt: 457  Z-score: 668.9  bits: 127.6 E(32554): 6.1e-31
Smith-Waterman score: 457; 100.0% identity (100.0% similar) in 69 aa overlap (1-69:1-69)

               10        20        30        40        50        60
pF1KE6 MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILS
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS80 MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILS
               10        20        30        40        50        60

                
pF1KE6 HLETYRRPE
       :::::::::
CCDS80 HLETYRRPE
                




69 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 10:14:34 2016 done: Tue Nov  8 10:14:34 2016
 Total Scan time:  1.130 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]