FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448
Query: pF1KE6193, 90 aa
1>>>pF1KE6193 90 - 90 aa - 90 aa
Library: human.CCDS.faa
18511270 residues in 32554 sequences
Statistics: Expectation_n fit: rho(ln(x))= 4.8807+/-0.000549; mu= 11.0919+/- 0.033
mean_var=57.7488+/-11.155, 0's: 0 Z-trim(112.4): 8 B-trim: 0 in 0/54
Lambda= 0.168773
statistics sampled from 13194 (13201) to 13194 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
ktup: 2, E-join: 1 (0.799), E-opt: 0.2 (0.406), width: 16
Scan time: 1.190
The best scores are: opt bits E(32554)
CCDS7959.1 TIMM10 gene_id:26519|Hs108|chr11 ( 90) 607 154.9 6.3e-39
>>CCDS7959.1 TIMM10 gene_id:26519|Hs108|chr11 (90 aa)
initn: 607 init1: 607 opt: 607 Z-score: 812.3 bits: 154.9 E(32554): 6.3e-39
Smith-Waterman score: 607; 100.0% identity (100.0% similar) in 90 aa overlap (1-90:1-90)
10 20 30 40 50 60
pF1KE6 MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLD
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS79 MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLD
10 20 30 40 50 60
70 80 90
pF1KE6 IHERMGKKLTELSMQDEELMKRVQQSSGPA
::::::::::::::::::::::::::::::
CCDS79 IHERMGKKLTELSMQDEELMKRVQQSSGPA
70 80 90
90 residues in 1 query sequences
18511270 residues in 32554 library sequences
Tcomplib [36.3.4 Apr, 2011] (8 proc)
start: Tue Nov 8 10:14:08 2016 done: Tue Nov 8 10:14:08 2016
Total Scan time: 1.190 Total Display time: -0.030
Function used was FASTA [36.3.4 Apr, 2011]