FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6172, 82 aa
  1>>>pF1KE6172 82 - 82 aa - 82 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.8167+/-0.000643; mu= 9.4076+/- 0.038
 mean_var=45.0926+/- 9.090, 0's: 0 Z-trim(108.6): 5  B-trim: 0 in 0/49
 Lambda= 0.190995
 statistics sampled from 10303 (10306) to 10303 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.73), E-opt: 0.2 (0.317), width:  16
 Scan time:  0.990

The best scores are:                                      opt bits E(32554)
CCDS34237.1 UQCRQ gene_id:27089|Hs108|chr5         (  82)  556 160.0 1.5e-40


>>CCDS34237.1 UQCRQ gene_id:27089|Hs108|chr5              (82 aa)
 initn: 556 init1: 556 opt: 556  Z-score: 841.3  bits: 160.0 E(32554): 1.5e-40
Smith-Waterman score: 556; 100.0% identity (100.0% similar) in 82 aa overlap (1-82:1-82)

               10        20        30        40        50        60
pF1KE6 MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIY
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS34 MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIY
               10        20        30        40        50        60

               70        80  
pF1KE6 TWGTEEFERSKRKNPAAYENDK
       ::::::::::::::::::::::
CCDS34 TWGTEEFERSKRKNPAAYENDK
               70        80  




82 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 10:03:42 2016 done: Tue Nov  8 10:03:42 2016
 Total Scan time:  0.990 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]