FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6170, 69 aa
  1>>>pF1KE6170 69 - 69 aa - 69 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.3578+/-0.000226; mu= 6.9574+/- 0.014
 mean_var=62.9555+/-12.313, 0's: 0 Z-trim(122.9): 2  B-trim: 0 in 0/54
 Lambda= 0.161643
 statistics sampled from 41736 (41738) to 41736 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.845), E-opt: 0.2 (0.489), width:  16
 Scan time:  3.160

The best scores are:                                      opt bits E(85289)
NP_009031 (OMIM: 601519) ATP synthase subunit e, m (  69)  435 108.6 8.2e-25


>>NP_009031 (OMIM: 601519) ATP synthase subunit e, mitoc  (69 aa)
 initn: 435 init1: 435 opt: 435  Z-score: 566.5  bits: 108.6 E(85289): 8.2e-25
Smith-Waterman score: 435; 100.0% identity (100.0% similar) in 69 aa overlap (1-69:1-69)

               10        20        30        40        50        60
pF1KE6 MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARE
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_009 MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARE
               10        20        30        40        50        60

                
pF1KE6 LAEDDSILK
       :::::::::
NP_009 LAEDDSILK
                




69 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 10:02:40 2016 done: Tue Nov  8 10:02:41 2016
 Total Scan time:  3.160 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]