FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6163, 55 aa
  1>>>pF1KE6163 55 - 55 aa - 55 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 3.8850+/-0.000211; mu= 12.4975+/- 0.013
 mean_var=36.2922+/- 7.365, 0's: 0 Z-trim(124.5): 10  B-trim: 71 in 1/59
 Lambda= 0.212896
 statistics sampled from 46278 (46289) to 46278 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.896), E-opt: 0.2 (0.543), width:  16
 Scan time:  3.000

The best scores are:                                      opt bits E(85289)
NP_061932 (OMIM: 607980) mitochondrial import rece (  55)  376 120.1 1.8e-28


>>NP_061932 (OMIM: 607980) mitochondrial import receptor  (55 aa)
 initn: 376 init1: 376 opt: 376  Z-score: 632.3  bits: 120.1 E(85289): 1.8e-28
Smith-Waterman score: 376; 100.0% identity (100.0% similar) in 55 aa overlap (1-55:1-55)

               10        20        30        40        50     
pF1KE6 MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG
       :::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_061 MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG
               10        20        30        40        50     




55 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 09:59:15 2016 done: Tue Nov  8 09:59:15 2016
 Total Scan time:  3.000 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]