FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448
Query: pF1KE6163, 55 aa
1>>>pF1KE6163 55 - 55 aa - 55 aa
Library: human.CCDS.faa
18511270 residues in 32554 sequences
Statistics: Expectation_n fit: rho(ln(x))= 3.8676+/-0.000391; mu= 12.6274+/- 0.024
mean_var=37.9243+/- 7.666, 0's: 0 Z-trim(117.4): 4 B-trim: 1091 in 1/52
Lambda= 0.208264
statistics sampled from 18124 (18127) to 18124 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
ktup: 2, E-join: 1 (0.9), E-opt: 0.2 (0.557), width: 16
Scan time: 1.280
The best scores are: opt bits E(32554)
CCDS5376.1 TOMM7 gene_id:54543|Hs108|chr7 ( 55) 376 117.8 3.5e-28
>>CCDS5376.1 TOMM7 gene_id:54543|Hs108|chr7 (55 aa)
initn: 376 init1: 376 opt: 376 Z-score: 619.5 bits: 117.8 E(32554): 3.5e-28
Smith-Waterman score: 376; 100.0% identity (100.0% similar) in 55 aa overlap (1-55:1-55)
10 20 30 40 50
pF1KE6 MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG
:::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS53 MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG
10 20 30 40 50
55 residues in 1 query sequences
18511270 residues in 32554 library sequences
Tcomplib [36.3.4 Apr, 2011] (8 proc)
start: Tue Nov 8 09:59:14 2016 done: Tue Nov 8 09:59:14 2016
Total Scan time: 1.280 Total Display time: -0.040
Function used was FASTA [36.3.4 Apr, 2011]