FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6141, 101 aa
  1>>>pF1KE6141 101 - 101 aa - 101 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.9208+/-0.000672; mu= 10.1627+/- 0.040
 mean_var=50.5113+/-10.534, 0's: 0 Z-trim(108.4): 20  B-trim: 7 in 1/48
 Lambda= 0.180460
 statistics sampled from 10173 (10178) to 10173 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.704), E-opt: 0.2 (0.313), width:  16
 Scan time:  1.280

The best scores are:                                      opt bits E(32554)
CCDS12474.1 PSENEN gene_id:55851|Hs108|chr19       ( 101)  709 191.9 5.8e-50


>>CCDS12474.1 PSENEN gene_id:55851|Hs108|chr19            (101 aa)
 initn: 709 init1: 709 opt: 709  Z-score: 1010.4  bits: 191.9 E(32554): 5.8e-50
Smith-Waterman score: 709; 100.0% identity (100.0% similar) in 101 aa overlap (1-101:1-101)

               10        20        30        40        50        60
pF1KE6 MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRS
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS12 MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRS
               10        20        30        40        50        60

               70        80        90       100 
pF1KE6 AVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP
       :::::::::::::::::::::::::::::::::::::::::
CCDS12 AVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP
               70        80        90       100 




101 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 09:49:13 2016 done: Tue Nov  8 09:49:13 2016
 Total Scan time:  1.280 Total Display time: -0.010

Function used was FASTA [36.3.4 Apr, 2011]