FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448
Query: pF1KE6135, 105 aa
1>>>pF1KE6135 105 - 105 aa - 105 aa
Library: human.CCDS.faa
18511270 residues in 32554 sequences
Statistics: Expectation_n fit: rho(ln(x))= 5.1714+/-0.000681; mu= 10.5625+/- 0.041
mean_var=58.3007+/-11.882, 0's: 0 Z-trim(109.2): 12 B-trim: 194 in 1/51
Lambda= 0.167972
statistics sampled from 10730 (10733) to 10730 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
ktup: 2, E-join: 1 (0.718), E-opt: 0.2 (0.33), width: 16
Scan time: 1.020
The best scores are: opt bits E(32554)
CCDS12147.1 RPL36 gene_id:25873|Hs108|chr19 ( 105) 677 171.5 8.3e-44
>>CCDS12147.1 RPL36 gene_id:25873|Hs108|chr19 (105 aa)
initn: 677 init1: 677 opt: 677 Z-score: 899.9 bits: 171.5 E(32554): 8.3e-44
Smith-Waterman score: 677; 100.0% identity (100.0% similar) in 105 aa overlap (1-105:1-105)
10 20 30 40 50 60
pF1KE6 MALRYPMAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMEL
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS12 MALRYPMAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMEL
10 20 30 40 50 60
70 80 90 100
pF1KE6 LKVSKDKRALKFIKKRVGTHIRAKRKREELSNVLAAMRKAAAKKD
:::::::::::::::::::::::::::::::::::::::::::::
CCDS12 LKVSKDKRALKFIKKRVGTHIRAKRKREELSNVLAAMRKAAAKKD
70 80 90 100
105 residues in 1 query sequences
18511270 residues in 32554 library sequences
Tcomplib [36.3.4 Apr, 2011] (8 proc)
start: Tue Nov 8 09:46:08 2016 done: Tue Nov 8 09:46:08 2016
Total Scan time: 1.020 Total Display time: -0.030
Function used was FASTA [36.3.4 Apr, 2011]