FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6131, 63 aa
  1>>>pF1KE6131 63 - 63 aa - 63 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.3861+/-0.000251; mu= 10.2819+/- 0.016
 mean_var=40.7168+/- 8.686, 0's: 0 Z-trim(120.1): 3  B-trim: 1268 in 1/52
 Lambda= 0.200996
 statistics sampled from 34983 (34986) to 34983 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.813), E-opt: 0.2 (0.41), width:  16
 Scan time:  3.450

The best scores are:                                      opt bits E(85289)
NP_001858 (OMIM: 603774) cytochrome c oxidase subu (  63)  420 127.6 1.3e-30


>>NP_001858 (OMIM: 603774) cytochrome c oxidase subunit   (63 aa)
 initn: 420 init1: 420 opt: 420  Z-score: 670.6  bits: 127.6 E(85289): 1.3e-30
Smith-Waterman score: 420; 100.0% identity (100.0% similar) in 63 aa overlap (1-63:1-63)

               10        20        30        40        50        60
pF1KE6 MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQL
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_001 MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQL
               10        20        30        40        50        60

          
pF1KE6 LKT
       :::
NP_001 LKT
          




63 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 09:43:42 2016 done: Tue Nov  8 09:43:43 2016
 Total Scan time:  3.450 Total Display time: -0.040

Function used was FASTA [36.3.4 Apr, 2011]