FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6102, 105 aa
  1>>>pF1KE6102 105 - 105 aa - 105 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.3255+/-0.000502; mu= 9.8784+/- 0.030
 mean_var=64.8888+/-12.962, 0's: 0 Z-trim(114.2): 6  B-trim: 763 in 1/52
 Lambda= 0.159217
 statistics sampled from 14767 (14772) to 14767 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.825), E-opt: 0.2 (0.454), width:  16
 Scan time:  1.480

The best scores are:                                      opt bits E(32554)
CCDS33173.1 LBH gene_id:81606|Hs108|chr2           ( 105)  720 172.8 3.4e-44


>>CCDS33173.1 LBH gene_id:81606|Hs108|chr2                (105 aa)
 initn: 720 init1: 720 opt: 720  Z-score: 906.9  bits: 172.8 E(32554): 3.4e-44
Smith-Waterman score: 720; 99.0% identity (99.0% similar) in 105 aa overlap (1-105:1-105)

               10        20        30        40        50        60
pF1KE6 MSIYFPIHCPDYLRSAKMTEVMMNTQPMEEIGLSPRKDGLSYQIFPDPSDFDRRCKLKDR
       ::::::::::::::::::::::::::::::::::::::::::::::::::::: ::::::
CCDS33 MSIYFPIHCPDYLRSAKMTEVMMNTQPMEEIGLSPRKDGLSYQIFPDPSDFDRCCKLKDR
               10        20        30        40        50        60

               70        80        90       100     
pF1KE6 LPSIVVEPTEGEVESGELRWPPEEFLVQEDEQDNCEETAKENKEQ
       :::::::::::::::::::::::::::::::::::::::::::::
CCDS33 LPSIVVEPTEGEVESGELRWPPEEFLVQEDEQDNCEETAKENKEQ
               70        80        90       100     




105 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 09:28:16 2016 done: Tue Nov  8 09:28:16 2016
 Total Scan time:  1.480 Total Display time: -0.010

Function used was FASTA [36.3.4 Apr, 2011]