FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE5149, 92 aa
  1>>>pF1KE5149 92 - 92 aa - 92 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.0417+/-0.000323; mu= 10.7863+/- 0.020
 mean_var=66.9994+/-13.996, 0's: 0 Z-trim(116.0): 1  B-trim: 0 in 0/55
 Lambda= 0.156689
 statistics sampled from 26766 (26767) to 26766 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.697), E-opt: 0.2 (0.314), width:  16
 Scan time:  3.530

The best scores are:                                      opt bits E(85289)
NP_000989 (OMIM: 613314) 60S ribosomal protein L37 (  92)  612 146.3 6.5e-36


>>NP_000989 (OMIM: 613314) 60S ribosomal protein L37a [H  (92 aa)
 initn: 612 init1: 612 opt: 612  Z-score: 765.7  bits: 146.3 E(85289): 6.5e-36
Smith-Waterman score: 612; 100.0% identity (100.0% similar) in 92 aa overlap (1-92:1-92)

               10        20        30        40        50        60
pF1KE5 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSC
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_000 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSC
               10        20        30        40        50        60

               70        80        90  
pF1KE5 MKTVAGGAWTYNTTSAVTVKSAIRRLKELKDQ
       ::::::::::::::::::::::::::::::::
NP_000 MKTVAGGAWTYNTTSAVTVKSAIRRLKELKDQ
               70        80        90  




92 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 07:21:09 2016 done: Tue Nov  8 07:21:10 2016
 Total Scan time:  3.530 Total Display time: -0.040

Function used was FASTA [36.3.4 Apr, 2011]