FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE5149, 92 aa
  1>>>pF1KE5149 92 - 92 aa - 92 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.9512+/-0.000693; mu= 5.5481+/- 0.041
 mean_var=64.6640+/-13.539, 0's: 0 Z-trim(109.5): 6  B-trim: 2 in 1/50
 Lambda= 0.159493
 statistics sampled from 10908 (10909) to 10908 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.721), E-opt: 0.2 (0.335), width:  16
 Scan time:  1.250

The best scores are:                                      opt bits E(32554)
CCDS2404.1 RPL37A gene_id:6168|Hs108|chr2          (  92)  612 148.8 4.4e-37


>>CCDS2404.1 RPL37A gene_id:6168|Hs108|chr2               (92 aa)
 initn: 612 init1: 612 opt: 612  Z-score: 779.2  bits: 148.8 E(32554): 4.4e-37
Smith-Waterman score: 612; 100.0% identity (100.0% similar) in 92 aa overlap (1-92:1-92)

               10        20        30        40        50        60
pF1KE5 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSC
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS24 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSC
               10        20        30        40        50        60

               70        80        90  
pF1KE5 MKTVAGGAWTYNTTSAVTVKSAIRRLKELKDQ
       ::::::::::::::::::::::::::::::::
CCDS24 MKTVAGGAWTYNTTSAVTVKSAIRRLKELKDQ
               70        80        90  




92 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 07:21:09 2016 done: Tue Nov  8 07:21:09 2016
 Total Scan time:  1.250 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]