FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE5145, 100 aa
  1>>>pF1KE5145 100 - 100 aa - 100 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.6874+/-0.000514; mu= 14.0385+/- 0.031
 mean_var=67.9154+/-13.358, 0's: 0 Z-trim(115.2): 2  B-trim: 0 in 0/50
 Lambda= 0.155629
 statistics sampled from 15763 (15765) to 15763 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.841), E-opt: 0.2 (0.484), width:  16
 Scan time:  1.510

The best scores are:                                      opt bits E(32554)
CCDS1134.1 BGLAP gene_id:632|Hs108|chr1            ( 100)  684 160.7 1.3e-40


>>CCDS1134.1 BGLAP gene_id:632|Hs108|chr1                 (100 aa)
 initn: 684 init1: 684 opt: 684  Z-score: 842.4  bits: 160.7 E(32554): 1.3e-40
Smith-Waterman score: 684; 100.0% identity (100.0% similar) in 100 aa overlap (1-100:1-100)

               10        20        30        40        50        60
pF1KE5 MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAP
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS11 MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAP
               10        20        30        40        50        60

               70        80        90       100
pF1KE5 VPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
       ::::::::::::::::::::::::::::::::::::::::
CCDS11 VPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
               70        80        90       100




100 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 07:20:30 2016 done: Tue Nov  8 07:20:30 2016
 Total Scan time:  1.510 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]