FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE5085, 61 aa
  1>>>pF1KE5085 61 - 61 aa - 61 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.4959+/-0.000242; mu= 10.0399+/- 0.015
 mean_var=42.1249+/- 8.402, 0's: 0 Z-trim(120.8): 1  B-trim: 1302 in 1/54
 Lambda= 0.197608
 statistics sampled from 36488 (36489) to 36488 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.811), E-opt: 0.2 (0.428), width:  16
 Scan time:  3.650

The best scores are:                                      opt bits E(85289)
NP_001794 (OMIM: 114280) CAMPATH-1 antigen precurs (  61)  380 114.1 1.4e-26


>>NP_001794 (OMIM: 114280) CAMPATH-1 antigen precursor [  (61 aa)
 initn: 380 init1: 380 opt: 380  Z-score: 598.2  bits: 114.1 E(85289): 1.4e-26
Smith-Waterman score: 380; 100.0% identity (100.0% similar) in 61 aa overlap (1-61:1-61)

               10        20        30        40        50        60
pF1KE5 MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCF
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_001 MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCF
               10        20        30        40        50        60

        
pF1KE5 S
       :
NP_001 S
        




61 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 04:53:00 2016 done: Tue Nov  8 04:53:00 2016
 Total Scan time:  3.650 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]