FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE5084, 54 aa
  1>>>pF1KE5084 54 - 54 aa - 54 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.4468+/-0.000389; mu= 10.2519+/- 0.024
 mean_var=49.8443+/- 9.911, 0's: 0 Z-trim(118.2): 1  B-trim: 89 in 1/50
 Lambda= 0.181663
 statistics sampled from 19089 (19090) to 19089 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.909), E-opt: 0.2 (0.586), width:  16
 Scan time:  1.060

The best scores are:                                      opt bits E(32554)
CCDS11975.1 PMAIP1 gene_id:5366|Hs108|chr18        (  54)  360 100.1 6.9e-23


>>CCDS11975.1 PMAIP1 gene_id:5366|Hs108|chr18             (54 aa)
 initn: 360 init1: 360 opt: 360  Z-score: 524.4  bits: 100.1 E(32554): 6.9e-23
Smith-Waterman score: 360; 100.0% identity (100.0% similar) in 54 aa overlap (1-54:1-54)

               10        20        30        40        50    
pF1KE5 MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS11 MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
               10        20        30        40        50    




54 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 04:52:28 2016 done: Tue Nov  8 04:52:28 2016
 Total Scan time:  1.060 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]