FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE3611, 95 aa
  1>>>pF1KE3611 95 - 95 aa - 95 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.8196+/-0.000492; mu= 12.4256+/- 0.030
 mean_var=62.1430+/-12.405, 0's: 0 Z-trim(115.1): 4  B-trim: 0 in 0/51
 Lambda= 0.162696
 statistics sampled from 15649 (15652) to 15649 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.838), E-opt: 0.2 (0.481), width:  16
 Scan time:  1.600

The best scores are:                                      opt bits E(32554)
CCDS11472.1 PPY gene_id:5539|Hs108|chr17           (  95)  637 156.5 2.3e-39


>>CCDS11472.1 PPY gene_id:5539|Hs108|chr17                (95 aa)
 initn: 637 init1: 637 opt: 637  Z-score: 820.2  bits: 156.5 E(32554): 2.3e-39
Smith-Waterman score: 637; 100.0% identity (100.0% similar) in 95 aa overlap (1-95:1-95)

               10        20        30        40        50        60
pF1KE3 MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYAADLRRYINML
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS11 MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYAADLRRYINML
               10        20        30        40        50        60

               70        80        90     
pF1KE3 TRPRYGKRHKEDTLAFSEWGSPHAAVPRELSPLDL
       :::::::::::::::::::::::::::::::::::
CCDS11 TRPRYGKRHKEDTLAFSEWGSPHAAVPRELSPLDL
               70        80        90     




95 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sun Nov  6 09:49:00 2016 done: Sun Nov  6 09:49:00 2016
 Total Scan time:  1.600 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]