FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE3011, 99 aa
  1>>>pF1KE3011 99 - 99 aa - 99 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.2656+/-0.000567; mu= 8.8539+/- 0.034
 mean_var=51.7423+/-10.308, 0's: 0 Z-trim(111.1): 14  B-trim: 111 in 1/50
 Lambda= 0.178300
 statistics sampled from 12126 (12135) to 12126 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.772), E-opt: 0.2 (0.373), width:  16
 Scan time:  1.550

The best scores are:                                      opt bits E(32554)
CCDS1777.1 DPY30 gene_id:84661|Hs108|chr2          (  99)  632 169.6 2.8e-43


>>CCDS1777.1 DPY30 gene_id:84661|Hs108|chr2               (99 aa)
 initn: 632 init1: 632 opt: 632  Z-score: 890.4  bits: 169.6 E(32554): 2.8e-43
Smith-Waterman score: 632; 100.0% identity (100.0% similar) in 99 aa overlap (1-99:1-99)

               10        20        30        40        50        60
pF1KE3 MEPEQMLEGQTQVAENPHSEYGLTDNVERIVENEKINAEKSSKQKVDLQSLPTRAYLDQT
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS17 MEPEQMLEGQTQVAENPHSEYGLTDNVERIVENEKINAEKSSKQKVDLQSLPTRAYLDQT
               10        20        30        40        50        60

               70        80        90         
pF1KE3 VVPILLQGLAVLAKERPPNPIEFLASYLLKNKAQFEDRN
       :::::::::::::::::::::::::::::::::::::::
CCDS17 VVPILLQGLAVLAKERPPNPIEFLASYLLKNKAQFEDRN
               70        80        90         




99 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sun Nov  6 18:34:25 2016 done: Sun Nov  6 18:34:25 2016
 Total Scan time:  1.550 Total Display time: -0.040

Function used was FASTA [36.3.4 Apr, 2011]