FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE3009, 92 aa
  1>>>pF1KE3009 92 - 92 aa - 92 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.6543+/-0.000527; mu= 11.8786+/- 0.032
 mean_var=48.5184+/- 9.528, 0's: 0 Z-trim(112.5): 6  B-trim: 20 in 1/50
 Lambda= 0.184128
 statistics sampled from 13265 (13268) to 13265 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.798), E-opt: 0.2 (0.408), width:  16
 Scan time:  1.230

The best scores are:                                      opt bits E(32554)
CCDS53368.1 RIIAD1 gene_id:284485|Hs108|chr1       (  92)  608 167.9 7.7e-43


>>CCDS53368.1 RIIAD1 gene_id:284485|Hs108|chr1            (92 aa)
 initn: 608 init1: 608 opt: 608  Z-score: 882.6  bits: 167.9 E(32554): 7.7e-43
Smith-Waterman score: 608; 100.0% identity (100.0% similar) in 92 aa overlap (1-92:1-92)

               10        20        30        40        50        60
pF1KE3 METLPGLLQRPDPGALSAAQLEQLRKFKIQTRIANEKYLRTHKEVEWLISGFFREIFLKR
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS53 METLPGLLQRPDPGALSAAQLEQLRKFKIQTRIANEKYLRTHKEVEWLISGFFREIFLKR
               10        20        30        40        50        60

               70        80        90  
pF1KE3 PDNILEFAADYFTDPRLPNKIHMQLIKDKKAA
       ::::::::::::::::::::::::::::::::
CCDS53 PDNILEFAADYFTDPRLPNKIHMQLIKDKKAA
               70        80        90  




92 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sun Nov  6 04:29:01 2016 done: Sun Nov  6 04:29:02 2016
 Total Scan time:  1.230 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]