FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE3007, 87 aa
  1>>>pF1KE3007 87 - 87 aa - 87 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.7590+/-0.000245; mu= 11.9384+/- 0.015
 mean_var=62.1871+/-12.155, 0's: 0 Z-trim(121.7): 1  B-trim: 0 in 0/52
 Lambda= 0.162639
 statistics sampled from 38587 (38588) to 38587 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.822), E-opt: 0.2 (0.452), width:  16
 Scan time:  3.920

The best scores are:                                      opt bits E(85289)
NP_056977 (OMIM: 602663) prolactin-releasing pepti (  87)  606 149.3 7.5e-37


>>NP_056977 (OMIM: 602663) prolactin-releasing peptide p  (87 aa)
 initn: 606 init1: 606 opt: 606  Z-score: 782.6  bits: 149.3 E(85289): 7.5e-37
Smith-Waterman score: 606; 100.0% identity (100.0% similar) in 87 aa overlap (1-87:1-87)

               10        20        30        40        50        60
pF1KE3 MKVLRAWLLCLLMLGLALRGAASRTHRHSMEIRTPDINPAWYASRGIRPVGRFGRRRATL
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_056 MKVLRAWLLCLLMLGLALRGAASRTHRHSMEIRTPDINPAWYASRGIRPVGRFGRRRATL
               10        20        30        40        50        60

               70        80       
pF1KE3 GDVPKPGLRPRLTCFPLEGGAMSSQDG
       :::::::::::::::::::::::::::
NP_056 GDVPKPGLRPRLTCFPLEGGAMSSQDG
               70        80       




87 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 04:54:42 2016 done: Tue Nov  8 04:54:42 2016
 Total Scan time:  3.920 Total Display time:  0.000

Function used was FASTA [36.3.4 Apr, 2011]