FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE3007, 87 aa
  1>>>pF1KE3007 87 - 87 aa - 87 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.6687+/-0.000488; mu= 12.3672+/- 0.029
 mean_var=59.1545+/-11.670, 0's: 0 Z-trim(114.9): 1  B-trim: 11 in 1/50
 Lambda= 0.166756
 statistics sampled from 15501 (15502) to 15501 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.837), E-opt: 0.2 (0.476), width:  16
 Scan time:  1.230

The best scores are:                                      opt bits E(32554)
CCDS2519.1 PRLH gene_id:51052|Hs108|chr2           (  87)  606 152.6 2.9e-38


>>CCDS2519.1 PRLH gene_id:51052|Hs108|chr2                (87 aa)
 initn: 606 init1: 606 opt: 606  Z-score: 800.5  bits: 152.6 E(32554): 2.9e-38
Smith-Waterman score: 606; 100.0% identity (100.0% similar) in 87 aa overlap (1-87:1-87)

               10        20        30        40        50        60
pF1KE3 MKVLRAWLLCLLMLGLALRGAASRTHRHSMEIRTPDINPAWYASRGIRPVGRFGRRRATL
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS25 MKVLRAWLLCLLMLGLALRGAASRTHRHSMEIRTPDINPAWYASRGIRPVGRFGRRRATL
               10        20        30        40        50        60

               70        80       
pF1KE3 GDVPKPGLRPRLTCFPLEGGAMSSQDG
       :::::::::::::::::::::::::::
CCDS25 GDVPKPGLRPRLTCFPLEGGAMSSQDG
               70        80       




87 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 04:54:41 2016 done: Tue Nov  8 04:54:41 2016
 Total Scan time:  1.230 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]