FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE3001, 68 aa
  1>>>pF1KE3001 68 - 68 aa - 68 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.2281+/-0.000523; mu= 12.3787+/- 0.031
 mean_var=53.5068+/-10.320, 0's: 0 Z-trim(114.3): 10  B-trim: 64 in 2/49
 Lambda= 0.175336
 statistics sampled from 14883 (14893) to 14883 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.821), E-opt: 0.2 (0.457), width:  16
 Scan time:  1.360

The best scores are:                                      opt bits E(32554)
CCDS5959.1 DEFB1 gene_id:1672|Hs108|chr8           (  68)  482 128.4 3.3e-31


>>CCDS5959.1 DEFB1 gene_id:1672|Hs108|chr8                (68 aa)
 initn: 482 init1: 482 opt: 482  Z-score: 673.7  bits: 128.4 E(32554): 3.3e-31
Smith-Waterman score: 482; 100.0% identity (100.0% similar) in 68 aa overlap (1-68:1-68)

               10        20        30        40        50        60
pF1KE3 MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCY
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS59 MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCY
               10        20        30        40        50        60

               
pF1KE3 RGKAKCCK
       ::::::::
CCDS59 RGKAKCCK
               




68 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sun Nov  6 04:31:14 2016 done: Sun Nov  6 04:31:14 2016
 Total Scan time:  1.360 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]