FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE2235, 102 aa
  1>>>pF1KE2235 102 - 102 aa - 102 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.7750+/-0.000288; mu= 11.8681+/- 0.018
 mean_var=53.2724+/-10.573, 0's: 0 Z-trim(117.1): 2  B-trim: 637 in 1/53
 Lambda= 0.175721
 statistics sampled from 28776 (28778) to 28776 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.746), E-opt: 0.2 (0.337), width:  16
 Scan time:  4.210

The best scores are:                                      opt bits E(85289)
NP_002148 (OMIM: 600141) 10 kDa heat shock protein ( 102)  656 173.4 5.5e-44


>>NP_002148 (OMIM: 600141) 10 kDa heat shock protein, mi  (102 aa)
 initn: 656 init1: 656 opt: 656  Z-score: 910.7  bits: 173.4 E(85289): 5.5e-44
Smith-Waterman score: 656; 100.0% identity (100.0% similar) in 102 aa overlap (1-102:1-102)

               10        20        30        40        50        60
pF1KE2 MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEI
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_002 MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEI
               10        20        30        40        50        60

               70        80        90       100  
pF1KE2 QPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
       ::::::::::::::::::::::::::::::::::::::::::
NP_002 QPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
               70        80        90       100  




102 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sun Nov  6 22:41:13 2016 done: Sun Nov  6 22:41:14 2016
 Total Scan time:  4.210 Total Display time: -0.040

Function used was FASTA [36.3.4 Apr, 2011]