FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE1587, 94 aa
  1>>>pF1KE1587 94 - 94 aa - 94 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.7435+/-0.000603; mu= 10.8753+/- 0.036
 mean_var=47.9831+/- 9.409, 0's: 0 Z-trim(109.9): 45  B-trim: 176 in 1/50
 Lambda= 0.185153
 statistics sampled from 11205 (11250) to 11205 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.742), E-opt: 0.2 (0.346), width:  16
 Scan time:  1.470

The best scores are:                                      opt bits E(32554)
CCDS10780.1 CCL17 gene_id:6361|Hs108|chr16         (  94)  621 172.7   3e-44


>>CCDS10780.1 CCL17 gene_id:6361|Hs108|chr16              (94 aa)
 initn: 621 init1: 621 opt: 621  Z-score: 908.0  bits: 172.7 E(32554): 3e-44
Smith-Waterman score: 621; 100.0% identity (100.0% similar) in 94 aa overlap (1-94:1-94)

               10        20        30        40        50        60
pF1KE1 MAPLKMLALVTLLLGASLQHIHAARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRD
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS10 MAPLKMLALVTLLLGASLQHIHAARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRD
               10        20        30        40        50        60

               70        80        90    
pF1KE1 AIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
       ::::::::::::::::::::::::::::::::::
CCDS10 AIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
               70        80        90    




94 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sun Nov  6 14:05:18 2016 done: Sun Nov  6 14:05:19 2016
 Total Scan time:  1.470 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]