FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE1579, 81 aa
  1>>>pF1KE1579 81 - 81 aa - 81 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.5803+/-0.000463; mu= 11.0388+/- 0.028
 mean_var=45.4287+/- 8.959, 0's: 0 Z-trim(113.8): 3  B-trim: 0 in 0/52
 Lambda= 0.190287
 statistics sampled from 14362 (14365) to 14362 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.829), E-opt: 0.2 (0.441), width:  16
 Scan time:  1.460

The best scores are:                                      opt bits E(32554)
CCDS106.1 CTNNBIP1 gene_id:56998|Hs108|chr1        (  81)  520 148.9 3.2e-37


>>CCDS106.1 CTNNBIP1 gene_id:56998|Hs108|chr1             (81 aa)
 initn: 520 init1: 520 opt: 520  Z-score: 781.6  bits: 148.9 E(32554): 3.2e-37
Smith-Waterman score: 520; 100.0% identity (100.0% similar) in 81 aa overlap (1-81:1-81)

               10        20        30        40        50        60
pF1KE1 MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSI
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS10 MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSI
               10        20        30        40        50        60

               70        80 
pF1KE1 DQGAEDVVMAFSRSETEDRRQ
       :::::::::::::::::::::
CCDS10 DQGAEDVVMAFSRSETEDRRQ
               70        80 




81 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sun Nov  6 19:32:24 2016 done: Sun Nov  6 19:32:25 2016
 Total Scan time:  1.460 Total Display time: -0.010

Function used was FASTA [36.3.4 Apr, 2011]