FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE1569, 87 aa
  1>>>pF1KE1569 87 - 87 aa - 87 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.5985+/-0.000591; mu= 11.3579+/- 0.035
 mean_var=45.8950+/- 8.989, 0's: 0 Z-trim(109.9): 10  B-trim: 30 in 1/52
 Lambda= 0.189318
 statistics sampled from 11184 (11188) to 11184 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.737), E-opt: 0.2 (0.344), width:  16
 Scan time:  1.260

The best scores are:                                      opt bits E(32554)
CCDS1225.1 FCER1G gene_id:2207|Hs108|chr1          (  86)  529 151.0 8.4e-38


>>CCDS1225.1 FCER1G gene_id:2207|Hs108|chr1               (86 aa)
 initn: 323 init1: 297 opt: 529  Z-score: 792.2  bits: 151.0 E(32554): 8.4e-38
Smith-Waterman score: 529; 98.9% identity (98.9% similar) in 87 aa overlap (1-87:1-86)

               10        20        30        40        50        60
pF1KE1 MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKVIQVRKAAITSYE
       ::::::::::::::::::::::::::::::::::::::::::::::: ::::::::::::
CCDS12 MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLK-IQVRKAAITSYE
               10        20        30        40         50         

               70        80       
pF1KE1 KSDGVYTGLSTRNQETYETLKHEKPPQ
       :::::::::::::::::::::::::::
CCDS12 KSDGVYTGLSTRNQETYETLKHEKPPQ
      60        70        80      




87 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sun Nov  6 23:58:30 2016 done: Sun Nov  6 23:58:30 2016
 Total Scan time:  1.260 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]