FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE1538, 117 aa
  1>>>pF1KE1538 117 - 117 aa - 117 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.9634+/-0.000617; mu= 14.0262+/- 0.037
 mean_var=83.5988+/-16.077, 0's: 0 Z-trim(113.7): 23  B-trim: 3 in 1/53
 Lambda= 0.140273
 statistics sampled from 14278 (14300) to 14278 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.805), E-opt: 0.2 (0.439), width:  16
 Scan time:  1.470

The best scores are:                                      opt bits E(32554)
CCDS13344.1 PI3 gene_id:5266|Hs108|chr20           ( 117)  813 172.7 4.7e-44


>>CCDS13344.1 PI3 gene_id:5266|Hs108|chr20                (117 aa)
 initn: 813 init1: 813 opt: 813  Z-score: 904.4  bits: 172.7 E(32554): 4.7e-44
Smith-Waterman score: 813; 100.0% identity (100.0% similar) in 117 aa overlap (1-117:1-117)

               10        20        30        40        50        60
pF1KE1 MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVK
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS13 MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVK
               10        20        30        40        50        60

               70        80        90       100       110       
pF1KE1 AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
       :::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS13 AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
               70        80        90       100       110       




117 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Mon Nov  7 01:52:51 2016 done: Mon Nov  7 01:52:52 2016
 Total Scan time:  1.470 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]