FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE1405, 100 aa
  1>>>pF1KE1405 100 - 100 aa - 100 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.8523+/-0.000644; mu= 12.1996+/- 0.039
 mean_var=59.2547+/-11.625, 0's: 0 Z-trim(109.7): 7  B-trim: 0 in 0/51
 Lambda= 0.166615
 statistics sampled from 11081 (11082) to 11081 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.746), E-opt: 0.2 (0.34), width:  16
 Scan time:  1.500

The best scores are:                                      opt bits E(32554)
CCDS1226.1 APOA2 gene_id:336|Hs108|chr1            ( 100)  622 156.9 1.9e-39


>>CCDS1226.1 APOA2 gene_id:336|Hs108|chr1                 (100 aa)
 initn: 622 init1: 622 opt: 622  Z-score: 821.6  bits: 156.9 E(32554): 1.9e-39
Smith-Waterman score: 622; 100.0% identity (100.0% similar) in 100 aa overlap (1-100:1-100)

               10        20        30        40        50        60
pF1KE1 MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAE
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS12 MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAE
               10        20        30        40        50        60

               70        80        90       100
pF1KE1 AKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
       ::::::::::::::::::::::::::::::::::::::::
CCDS12 AKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
               70        80        90       100




100 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Mon Nov  7 02:21:17 2016 done: Mon Nov  7 02:21:18 2016
 Total Scan time:  1.500 Total Display time: -0.050

Function used was FASTA [36.3.4 Apr, 2011]