FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE1392, 93 aa
  1>>>pF1KE1392 93 - 93 aa - 93 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.0719+/-0.000547; mu= 10.0828+/- 0.033
 mean_var=53.9655+/-10.651, 0's: 0 Z-trim(112.6): 5  B-trim: 0 in 0/51
 Lambda= 0.174589
 statistics sampled from 13292 (13296) to 13292 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.798), E-opt: 0.2 (0.408), width:  16
 Scan time:  1.560

The best scores are:                                      opt bits E(32554)
CCDS4287.1 SCGB3A2 gene_id:117156|Hs108|chr5       (  93)  582 153.5 1.8e-38


>>CCDS4287.1 SCGB3A2 gene_id:117156|Hs108|chr5            (93 aa)
 initn: 582 init1: 582 opt: 582  Z-score: 804.2  bits: 153.5 E(32554): 1.8e-38
Smith-Waterman score: 582; 100.0% identity (100.0% similar) in 93 aa overlap (1-93:1-93)

               10        20        30        40        50        60
pF1KE1 MKLVTIFLLVTISLCSYSATAFLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISV
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS42 MKLVTIFLLVTISLCSYSATAFLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISV
               10        20        30        40        50        60

               70        80        90   
pF1KE1 EHLVEGLRKCVNELGPEASEAVKKLLEALSHLV
       :::::::::::::::::::::::::::::::::
CCDS42 EHLVEGLRKCVNELGPEASEAVKKLLEALSHLV
               70        80        90   




93 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Mon Nov  7 00:34:06 2016 done: Mon Nov  7 00:34:06 2016
 Total Scan time:  1.560 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]