FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KB9799, 117 aa
  1>>>pF1KB9799 117 - 117 aa - 117 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.9154+/-0.000563; mu= 10.9435+/- 0.034
 mean_var=116.4797+/-22.588, 0's: 0 Z-trim(117.7): 11  B-trim: 0 in 0/55
 Lambda= 0.118836
 statistics sampled from 18435 (18446) to 18435 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.874), E-opt: 0.2 (0.567), width:  16
 Scan time:  1.710

The best scores are:                                      opt bits E(32554)
CCDS14504.1 TCEAL8 gene_id:90843|Hs108|chrX        ( 117)  839 152.5 5.4e-38


>>CCDS14504.1 TCEAL8 gene_id:90843|Hs108|chrX             (117 aa)
 initn: 839 init1: 839 opt: 839  Z-score: 795.6  bits: 152.5 E(32554): 5.4e-38
Smith-Waterman score: 839; 100.0% identity (100.0% similar) in 117 aa overlap (1-117:1-117)

               10        20        30        40        50        60
pF1KB9 MQKSCEENEGKPQNMPKAEEDRPLEDVPQEAEGNPQPSEEGVSQEAEGNPRGGPNQPGQG
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS14 MQKSCEENEGKPQNMPKAEEDRPLEDVPQEAEGNPQPSEEGVSQEAEGNPRGGPNQPGQG
               10        20        30        40        50        60

               70        80        90       100       110       
pF1KB9 FKEDTPVRHLDPEEMIRGVDELERLREEIRRVRNKFVMMHWKQRHSRSRPYPVCFRP
       :::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS14 FKEDTPVRHLDPEEMIRGVDELERLREEIRRVRNKFVMMHWKQRHSRSRPYPVCFRP
               70        80        90       100       110       




117 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Fri Nov  4 19:03:02 2016 done: Fri Nov  4 19:03:03 2016
 Total Scan time:  1.710 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]