FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KB8747, 31 aa
  1>>>pF1KB8747 31 - 31 aa - 31 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 1.9395+/-0.000415; mu= 17.4417+/- 0.026
 mean_var=31.1445+/- 6.540, 0's: 0 Z-trim(114.8): 6  B-trim: 835 in 1/52
 Lambda= 0.229818
 statistics sampled from 15350 (15353) to 15350 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.886), E-opt: 0.2 (0.472), width:  16
 Scan time:  0.920

The best scores are:                                      opt bits E(32554)
CCDS31667.1 SLN gene_id:6588|Hs108|chr11           (  31)  195 68.5 7.6e-14


>>CCDS31667.1 SLN gene_id:6588|Hs108|chr11                (31 aa)
 initn: 195 init1: 195 opt: 195  Z-score: 362.1  bits: 68.5 E(32554): 7.6e-14
Smith-Waterman score: 195; 100.0% identity (100.0% similar) in 31 aa overlap (1-31:1-31)

               10        20        30 
pF1KB8 MGINTRELFLNFTIVLITVILMWLLVRSYQY
       :::::::::::::::::::::::::::::::
CCDS31 MGINTRELFLNFTIVLITVILMWLLVRSYQY
               10        20        30 




31 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Fri Nov  4 15:11:34 2016 done: Fri Nov  4 15:11:34 2016
 Total Scan time:  0.920 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]