[UP]
[1][TOP]
>UniRef100_C6TBX4 Putative uncharacterized protein n=1 Tax=Glycine max
RepID=C6TBX4_SOYBN
Length = 234
Score = 55.1 bits (131), Expect = 2e-06
Identities = 30/39 (76%), Positives = 33/39 (84%), Gaps = 4/39 (10%)
Frame = +2
Query: 17 KSTSLTSRTSIVAPERVVFKKVPLQY----TSGRVVSIR 121
KSTSL+SRTSI AP+R+VFKKV LQY TSGRVVSIR
Sbjct: 15 KSTSLSSRTSITAPDRIVFKKVSLQYRDVSTSGRVVSIR 53