[UP]
[1][TOP] >UniRef100_B7FIY1 Putative uncharacterized protein n=1 Tax=Medicago truncatula RepID=B7FIY1_MEDTR Length = 263 Score = 84.0 bits (206), Expect = 5e-15 Identities = 40/55 (72%), Positives = 40/55 (72%), Gaps = 11/55 (20%) Frame = -2 Query: 407 PQPAPYGQPYGYPPAPPPAQGYPAT-----------GYPPAAYPPPGYPPSGYSR 276 PQPA YGQ YGYPPAPPPAQGYPAT GYPP AYPP GYPPSGYSR Sbjct: 210 PQPA-YGQNYGYPPAPPPAQGYPATGYPSAAYPPQQGYPPTAYPPQGYPPSGYSR 263 [2][TOP] >UniRef100_A9PCV7 Putative uncharacterized protein n=1 Tax=Populus trichocarpa RepID=A9PCV7_POPTR Length = 253 Score = 72.0 bits (175), Expect = 2e-11 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = -2 Query: 395 PYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 276 PYGQPYGYPP P QGYP GYPP+ YPPP YPPSGY + Sbjct: 216 PYGQPYGYPPQPH--QGYPVAGYPPSNYPPPAYPPSGYPK 253 [3][TOP] >UniRef100_B9GKE8 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GKE8_POPTR Length = 94 Score = 70.1 bits (170), Expect = 7e-11 Identities = 30/42 (71%), Positives = 31/42 (73%) Frame = -2 Query: 401 PAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 276 P YGQPYGYPP AQGYPA GYPP AYPP YPPSGY + Sbjct: 56 PQGYGQPYGYPPQ---AQGYPAAGYPPPAYPPSNYPPSGYPK 94 [4][TOP] >UniRef100_A9PIT6 Putative uncharacterized protein n=1 Tax=Populus trichocarpa x Populus deltoides RepID=A9PIT6_9ROSI Length = 248 Score = 70.1 bits (170), Expect = 7e-11 Identities = 30/42 (71%), Positives = 31/42 (73%) Frame = -2 Query: 401 PAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 276 P YGQPYGYPP AQGYPA GYPP AYPP YPPSGY + Sbjct: 210 PQGYGQPYGYPPQ---AQGYPAAGYPPPAYPPSNYPPSGYPK 248 [5][TOP] >UniRef100_C6SXX5 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6SXX5_SOYBN Length = 248 Score = 67.0 bits (162), Expect = 6e-10 Identities = 33/45 (73%), Positives = 34/45 (75%), Gaps = 1/45 (2%) Frame = -2 Query: 407 PQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 276 PQPA YGQP GYP A GYP TGYPPAAYPPPGYPPSGY + Sbjct: 210 PQPA-YGQPAQGYP-----APGYPPTGYPPAAYPPPGYPPSGYPK 248 [6][TOP] >UniRef100_A9RJ18 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RJ18_PHYPA Length = 377 Score = 66.6 bits (161), Expect = 8e-10 Identities = 27/40 (67%), Positives = 29/40 (72%) Frame = -2 Query: 395 PYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 276 P G P GYPPA P GYP +GYPP+ YPP GYPPSGY R Sbjct: 230 PPGAPAGYPPAGYPPAGYPPSGYPPSGYPPSGYPPSGYPR 269 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = -2 Query: 407 PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 282 PQ P + YPP P GYP GYPPA YPP GYPPSGY Sbjct: 218 PQGYPPQGGHAYPPGAPA--GYPPAGYPPAGYPPSGYPPSGY 257 [7][TOP] >UniRef100_B9N0Q7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9N0Q7_POPTR Length = 175 Score = 64.7 bits (156), Expect = 3e-09 Identities = 28/42 (66%), Positives = 28/42 (66%) Frame = -2 Query: 407 PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 282 PQP Y P GYPP P QGYP GYPPA YPP YPPSGY Sbjct: 32 PQPGAY-PPQGYPPQGYPPQGYPPQGYPPAGYPPGAYPPSGY 72 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/39 (64%), Positives = 27/39 (69%), Gaps = 2/39 (5%) Frame = -2 Query: 392 YGQPYGYPPAPP--PAQGYPATGYPPAAYPPPGYPPSGY 282 +G P GYPP P P QGYP GYPP YPP GYPP+GY Sbjct: 25 HGAP-GYPPQPGAYPPQGYPPQGYPPQGYPPQGYPPAGY 62 [8][TOP] >UniRef100_A9P8F5 Putative uncharacterized protein n=1 Tax=Populus trichocarpa RepID=A9P8F5_POPTR Length = 189 Score = 64.7 bits (156), Expect = 3e-09 Identities = 28/42 (66%), Positives = 28/42 (66%) Frame = -2 Query: 407 PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 282 PQP Y P GYPP P QGYP GYPPA YPP YPPSGY Sbjct: 32 PQPGAY-PPQGYPPQGYPPQGYPPQGYPPAGYPPGAYPPSGY 72 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/39 (64%), Positives = 27/39 (69%), Gaps = 2/39 (5%) Frame = -2 Query: 392 YGQPYGYPPAPP--PAQGYPATGYPPAAYPPPGYPPSGY 282 +G P GYPP P P QGYP GYPP YPP GYPP+GY Sbjct: 25 HGAP-GYPPQPGAYPPQGYPPQGYPPQGYPPQGYPPAGY 62 [9][TOP] >UniRef100_B9RDV3 Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9RDV3_RICCO Length = 248 Score = 63.2 bits (152), Expect = 9e-09 Identities = 31/49 (63%), Positives = 32/49 (65%), Gaps = 5/49 (10%) Frame = -2 Query: 407 PQPAPYGQP----YGYPPAPPPAQGYPATGYPPAAYPPPG-YPPSGYSR 276 P P P G P YG PP PP AQGYP GYPP YPPPG YPPSGY + Sbjct: 201 PIPPPIGYPPQPAYGQPP-PPYAQGYPPAGYPPPQYPPPGAYPPSGYPK 248 [10][TOP] >UniRef100_Q0D316 Rhodopsin (Fragment) n=1 Tax=Megalocranchia fisheri RepID=Q0D316_9MOLL Length = 298 Score = 63.2 bits (152), Expect = 9e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -2 Query: 404 QPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 285 QPA Y P GYPP P QGYP GYPP YPP GYPP G Sbjct: 244 QPAGYPPPAGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQG 283 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -2 Query: 386 QPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 282 QP GYPP PA GYP GYPP YPP GYPP GY Sbjct: 244 QPAGYPP---PA-GYPPQGYPPQGYPPQGYPPQGY 274 [11][TOP] >UniRef100_B9RCF3 Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9RCF3_RICCO Length = 244 Score = 62.8 bits (151), Expect = 1e-08 Identities = 30/45 (66%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = -2 Query: 407 PQPAPYGQPYGYPPAPPPAQGYPATGYPPAA-YPPPGYPPSGYSR 276 P A YGQPY AQGYPA+GYPP + YPPPGYPPSGYSR Sbjct: 208 PPQAAYGQPY--------AQGYPASGYPPPSNYPPPGYPPSGYSR 244 [12][TOP] >UniRef100_Q8H8G4 Putative uncharacterized protein OJ1126B12.17 n=1 Tax=Oryza sativa Japonica Group RepID=Q8H8G4_ORYSJ Length = 241 Score = 62.4 bits (150), Expect = 2e-08 Identities = 33/49 (67%), Positives = 33/49 (67%), Gaps = 8/49 (16%) Frame = -2 Query: 407 PQPAPYGQPYG-YPPAPPPAQGYPATGYPPA------AYPPPG-YPPSG 285 PQ YGQPYG YPPAPP AQGYP YPPA AYPPPG YPP G Sbjct: 177 PQQPAYGQPYGGYPPAPP-AQGYPPAAYPPAGYPQGGAYPPPGSYPPPG 224 [13][TOP] >UniRef100_Q10SG5 Os03g0123600 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q10SG5_ORYSJ Length = 274 Score = 62.4 bits (150), Expect = 2e-08 Identities = 33/49 (67%), Positives = 33/49 (67%), Gaps = 8/49 (16%) Frame = -2 Query: 407 PQPAPYGQPYG-YPPAPPPAQGYPATGYPPA------AYPPPG-YPPSG 285 PQ YGQPYG YPPAPP AQGYP YPPA AYPPPG YPP G Sbjct: 210 PQQPAYGQPYGGYPPAPP-AQGYPPAAYPPAGYPQGGAYPPPGSYPPPG 257 [14][TOP] >UniRef100_B8ALY9 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8ALY9_ORYSI Length = 274 Score = 62.4 bits (150), Expect = 2e-08 Identities = 33/49 (67%), Positives = 33/49 (67%), Gaps = 8/49 (16%) Frame = -2 Query: 407 PQPAPYGQPYG-YPPAPPPAQGYPATGYPPA------AYPPPG-YPPSG 285 PQ YGQPYG YPPAPP AQGYP YPPA AYPPPG YPP G Sbjct: 210 PQQPAYGQPYGGYPPAPP-AQGYPPAAYPPAGYPQGGAYPPPGSYPPPG 257 [15][TOP] >UniRef100_A9NZ64 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NZ64_PICSI Length = 218 Score = 62.0 bits (149), Expect = 2e-08 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -2 Query: 383 PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 282 P GYPP+ P GYP +GYPPA YPP GYPPSGY Sbjct: 33 PSGYPPSGYPPSGYPPSGYPPAGYPPSGYPPSGY 66 Score = 60.5 bits (145), Expect = 6e-08 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = -2 Query: 383 PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 282 P GYPP+ P GYP GYPP+ YPP GYPPSGY Sbjct: 38 PSGYPPSGYPPSGYPPAGYPPSGYPPSGYPPSGY 71 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/32 (68%), Positives = 25/32 (78%) Frame = -2 Query: 377 GYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 282 GYPP+ P GYP +GYPP+ YPP GYPPSGY Sbjct: 30 GYPPSGYPPSGYPPSGYPPSGYPPAGYPPSGY 61 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = -2 Query: 383 PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 282 P GYPPA P GYP +GYPP+ YP GYPPSGY Sbjct: 48 PSGYPPAGYPPSGYPPSGYPPSGYPSSGYPPSGY 81 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/39 (61%), Positives = 28/39 (71%) Frame = -2 Query: 401 PAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 285 PA Y P GYPP+ P GYP++GYPP+ YPP GYPP G Sbjct: 53 PAGY-PPSGYPPSGYPPSGYPSSGYPPSGYPPAGYPPQG 90 Score = 57.4 bits (137), Expect = 5e-07 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = -2 Query: 383 PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 282 P GYPP+ P GYP +GYPP+ YPP GYP SGY Sbjct: 43 PSGYPPSGYPPAGYPPSGYPPSGYPPSGYPSSGY 76 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = -2 Query: 383 PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 282 P GYPP+ P GYP +GYP + YPP GYPP+GY Sbjct: 53 PAGYPPSGYPPSGYPPSGYPSSGYPPSGYPPAGY 86 [16][TOP] >UniRef100_A9NRB0 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NRB0_PICSI Length = 208 Score = 62.0 bits (149), Expect = 2e-08 Identities = 26/38 (68%), Positives = 28/38 (73%), Gaps = 1/38 (2%) Frame = -2 Query: 392 YGQ-PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 282 +GQ P GYPP+ P GYP GYPPA YPP GYPPSGY Sbjct: 24 HGQSPSGYPPSGYPPSGYPPAGYPPAGYPPAGYPPSGY 61 Score = 60.1 bits (144), Expect = 8e-08 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = -2 Query: 383 PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 282 P GYPP+ P GYP GYPPA YPP GYPP+GY Sbjct: 33 PSGYPPSGYPPAGYPPAGYPPAGYPPSGYPPAGY 66 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = -2 Query: 383 PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 285 P GYPPA P GYP GYPP+ YPP GYPP G Sbjct: 38 PSGYPPAGYPPAGYPPAGYPPSGYPPAGYPPQG 70 [17][TOP] >UniRef100_Q0D320 Rhodopsin (Fragment) n=1 Tax=Enoploteuthis higginsi RepID=Q0D320_9MOLL Length = 134 Score = 62.0 bits (149), Expect = 2e-08 Identities = 28/42 (66%), Positives = 28/42 (66%), Gaps = 2/42 (4%) Frame = -2 Query: 404 QPAPYGQPYGYPPA--PPPAQGYPATGYPPAAYPPPGYPPSG 285 QPA Y P GYPP PPP QGYP GYPP YPP GYPP G Sbjct: 82 QPA-YPPPQGYPPQGYPPPPQGYPPQGYPPQGYPPQGYPPQG 122 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/42 (59%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Frame = -2 Query: 401 PAPYGQP-YGYPPAPP--PAQGYPATGYPPAAYPPPGYPPSG 285 P P G P GYPP P P QGYP GYPP YPP G PP+G Sbjct: 86 PPPQGYPPQGYPPPPQGYPPQGYPPQGYPPQGYPPQGAPPAG 127 [18][TOP] >UniRef100_P09241 Rhodopsin n=1 Tax=Enteroctopus dofleini RepID=OPSD_ENTDO Length = 455 Score = 61.2 bits (147), Expect = 3e-08 Identities = 28/44 (63%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = -2 Query: 407 PQPAPYGQP-YGYPP--APPPAQGYPATGYPPAAYPPPGYPPSG 285 P P P G P GYPP A PP QGYP GYPP YPP GYPP G Sbjct: 389 PPPPPQGYPPQGYPPQGAYPPPQGYPPQGYPPQGYPPQGYPPQG 432 [19][TOP] >UniRef100_Q0D313 Rhodopsin (Fragment) n=1 Tax=Illex coindetii RepID=Q0D313_9MOLL Length = 286 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = -2 Query: 407 PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 282 PQP P P GYPP P QGYP GYPP YPP GYPP GY Sbjct: 230 PQPPP---PQGYPPPP---QGYPPQGYPPQGYPPQGYPPQGY 265 [20][TOP] >UniRef100_Q0D319 Rhodopsin (Fragment) n=1 Tax=Octopoteuthis nielseni RepID=Q0D319_9MOLL Length = 130 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/42 (61%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = -2 Query: 404 QPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 282 Q P G P GYPP P QGYP GYPP YPP GYPP GY Sbjct: 81 QAPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGY 122 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -2 Query: 407 PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPP 291 PQ P P GYPP P QGYP GYPP YPP GYPP Sbjct: 89 PQGYP---PQGYPPQGYPPQGYPPQGYPPQGYPPQGYPP 124 [21][TOP] >UniRef100_Q3BDP2 Rhodopsin (Fragment) n=1 Tax=Sepioteuthis australis RepID=Q3BDP2_9MOLL Length = 294 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/41 (65%), Positives = 27/41 (65%) Frame = -2 Query: 404 QPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 282 Q A Y P GYPP PP QGYP GYPP YPP GYPP GY Sbjct: 246 QQAAY-PPQGYPPPPP--QGYPPQGYPPQGYPPQGYPPQGY 283 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/42 (59%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = -2 Query: 407 PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPP-GYPPSG 285 PQ P P GYPP P QGYP GYPP YPPP G PP G Sbjct: 252 PQGYPPPPPQGYPPQGYPPQGYPPQGYPPQGYPPPQGPPPQG 293 [22][TOP] >UniRef100_Q3BDP1 Rhodopsin (Fragment) n=1 Tax=Sepioteuthis lessoniana RepID=Q3BDP1_SEPLE Length = 288 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/41 (65%), Positives = 27/41 (65%) Frame = -2 Query: 404 QPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 282 Q A Y P GYPP PP QGYP GYPP YPP GYPP GY Sbjct: 247 QQAAY-PPQGYPPPPP--QGYPPQGYPPQGYPPQGYPPQGY 284 [23][TOP] >UniRef100_Q0D323 Rhodopsin (Fragment) n=1 Tax=Architeuthis sp. JMS-2004 RepID=Q0D323_9MOLL Length = 137 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/42 (61%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = -2 Query: 407 PQPAPYGQPYGYPPAP-PPAQGYPATGYPPAAYPPPGYPPSG 285 P PA Y P GYPP PP QGYP GYPP YPP G PP G Sbjct: 86 PPPAGYPPPQGYPPQGYPPPQGYPPQGYPPQGYPPQGAPPQG 127 [24][TOP] >UniRef100_B4YS99 Rhodopsin (Fragment) n=1 Tax=Afrololigo mercatoris RepID=B4YS99_9MOLL Length = 303 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/42 (64%), Positives = 28/42 (66%), Gaps = 3/42 (7%) Frame = -2 Query: 404 QPAPYGQPYGYPPA---PPPAQGYPATGYPPAAYPPPGYPPS 288 QPA Y P GYPP PPP QGYP GYPP YPP GYPP+ Sbjct: 247 QPA-YPPPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPPA 287 [25][TOP] >UniRef100_C4R4X2 Protein involved in positive regulation of both 1,3-beta-glucan synthesis and the Pkc1p-MAPK pathway n=1 Tax=Pichia pastoris GS115 RepID=C4R4X2_PICPG Length = 1338 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/42 (61%), Positives = 27/42 (64%) Frame = -2 Query: 407 PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 282 PQ P P GYPP P QGYP GYPP YPP GYPPSG+ Sbjct: 999 PQGYP---PQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPSGF 1037 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = -2 Query: 377 GYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 282 GYPP P QGYP GYPP YPP GYPP GY Sbjct: 996 GYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGY 1027 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = -2 Query: 383 PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 282 P GYP P+QGYP GYPP YPP GYPP GY Sbjct: 984 PKGYPTEGYPSQGYPPQGYPPQGYPPQGYPPQGY 1017 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/42 (57%), Positives = 25/42 (59%) Frame = -2 Query: 407 PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 282 PQ P P GYPP P QGYP GYPP YPP G+PP Y Sbjct: 1004 PQGYP---PQGYPPQGYPPQGYPPQGYPPQGYPPSGFPPQSY 1042 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/40 (60%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = -2 Query: 398 APYGQPY-GYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 282 +P G P GYP P QGYP GYPP YPP GYPP GY Sbjct: 983 SPKGYPTEGYPSQGYPPQGYPPQGYPPQGYPPQGYPPQGY 1022 [26][TOP] >UniRef100_Q0D318 Rhodopsin (Fragment) n=1 Tax=Bathyteuthis abyssicola RepID=Q0D318_9MOLL Length = 170 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/39 (64%), Positives = 25/39 (64%), Gaps = 2/39 (5%) Frame = -2 Query: 395 PYGQPYGYPPA--PPPAQGYPATGYPPAAYPPPGYPPSG 285 P P GYPP PPP QGYP GYPP YPP GYPP G Sbjct: 116 PAYPPQGYPPQGYPPPPQGYPPQGYPPQGYPPQGYPPQG 154 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/45 (60%), Positives = 27/45 (60%), Gaps = 5/45 (11%) Frame = -2 Query: 404 QPA--PYGQP-YGYPPAPP--PAQGYPATGYPPAAYPPPGYPPSG 285 QPA P G P GYPP P P QGYP GYPP YPP G PP G Sbjct: 115 QPAYPPQGYPPQGYPPPPQGYPPQGYPPQGYPPQGYPPQGAPPQG 159 [27][TOP] >UniRef100_Q9LF59 Glycine/proline-rich protein n=1 Tax=Arabidopsis thaliana RepID=Q9LF59_ARATH Length = 173 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/43 (62%), Positives = 28/43 (65%), Gaps = 1/43 (2%) Frame = -2 Query: 407 PQPAPYGQPYGYPP-APPPAQGYPATGYPPAAYPPPGYPPSGY 282 P P P P+GYPP A PP GYP GYPPA YPP GYP GY Sbjct: 46 PPPPP---PHGYPPVAYPPHGGYPPAGYPPAGYPPAGYPAHGY 85 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/38 (63%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = -2 Query: 392 YGQPYGYPPAPPPAQGYPATGYPP-AAYPPPGYPPSGY 282 YG Y YPP PPP GYP YPP YPP GYPP+GY Sbjct: 39 YGSSYPYPPPPPP-HGYPPVAYPPHGGYPPAGYPPAGY 75 [28][TOP] >UniRef100_Q0WWS8 Glycine/proline-rich protein n=1 Tax=Arabidopsis thaliana RepID=Q0WWS8_ARATH Length = 173 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/43 (62%), Positives = 28/43 (65%), Gaps = 1/43 (2%) Frame = -2 Query: 407 PQPAPYGQPYGYPP-APPPAQGYPATGYPPAAYPPPGYPPSGY 282 P P P P+GYPP A PP GYP GYPPA YPP GYP GY Sbjct: 46 PPPPP---PHGYPPVAYPPHGGYPPAGYPPAGYPPAGYPAHGY 85 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/38 (63%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = -2 Query: 392 YGQPYGYPPAPPPAQGYPATGYPP-AAYPPPGYPPSGY 282 YG Y YPP PPP GYP YPP YPP GYPP+GY Sbjct: 39 YGSSYPYPPPPPP-HGYPPVAYPPHGGYPPAGYPPAGY 75 [29][TOP] >UniRef100_Q3BDN9 Rhodopsin (Fragment) n=1 Tax=Loliolus sp. JMS-2004 RepID=Q3BDN9_9MOLL Length = 297 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 3/43 (6%) Frame = -2 Query: 404 QPAPYGQPYGYPPA---PPPAQGYPATGYPPAAYPPPGYPPSG 285 Q A Y P GYPP PPP QGYP GYPP YPP GYPP G Sbjct: 246 QQAAY-PPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPPQG 287 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/44 (59%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Frame = -2 Query: 407 PQPAPYGQPYGYPPAPP---PAQGYPATGYPPAAYPPPGYPPSG 285 PQ P P GYPP PP P QGYP GYPP YPP G PP G Sbjct: 252 PQGYP---PQGYPPPPPQGYPPQGYPPQGYPPQGYPPQGAPPQG 292 [30][TOP] >UniRef100_Q0D321 Rhodopsin (Fragment) n=1 Tax=Abraliopsis pacificus RepID=Q0D321_9MOLL Length = 299 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 1/41 (2%) Frame = -2 Query: 404 QPAPYGQPYGYPPAP-PPAQGYPATGYPPAAYPPPGYPPSG 285 QPA Y P GYPP PP QGYP GYPP YPP GYPP G Sbjct: 248 QPA-YPPPQGYPPQGYPPPQGYPPQGYPPQGYPPQGYPPQG 287 [31][TOP] >UniRef100_Q0D314 Rhodopsin (Fragment) n=1 Tax=Cranchia scabra RepID=Q0D314_9MOLL Length = 278 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 383 PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 282 P GYPP P QGYP GYPP YPP GYPP GY Sbjct: 238 PAGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGY 271 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -2 Query: 401 PAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 285 PA Y P GYPP P QGYP GYPP YPP GYPP G Sbjct: 238 PAGY-PPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQG 275 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -2 Query: 371 PPAPPPAQGYPATGYPPAAYPPPGYPPSGY 282 PPA P QGYP GYPP YPP GYPP GY Sbjct: 237 PPAGYPPQGYPPQGYPPQGYPPQGYPPQGY 266 [32][TOP] >UniRef100_A0JMY8 Plscr2 protein n=1 Tax=Xenopus laevis RepID=A0JMY8_XENLA Length = 354 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = -2 Query: 407 PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 282 P P PYGY PA P GY TGYPPA Y P GYPP+GY Sbjct: 26 PGYPPPQNPYGYQPAGYPPAGYQPTGYPPAGYQPAGYPPAGY 67 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/43 (60%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = -2 Query: 407 PQPAPYG-QPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 282 P PYG QP GYPPA GYP GY PA YPP GY P+GY Sbjct: 30 PPQNPYGYQPAGYPPAGYQPTGYPPAGYQPAGYPPAGYQPAGY 72 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/40 (62%), Positives = 26/40 (65%) Frame = -2 Query: 401 PAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 282 PA Y QP GYPPA GYP GY PA YPP GY P+GY Sbjct: 44 PAGY-QPTGYPPAGYQPAGYPPAGYQPAGYPPAGYQPAGY 82 [33][TOP] >UniRef100_A9NZ96 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NZ96_PICSI Length = 257 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/44 (54%), Positives = 27/44 (61%) Frame = -2 Query: 407 PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 276 P PYGQP P P Q YPA GYPP+ YP GYPP+GY + Sbjct: 214 PAQPPYGQPAYPQPYGYPTQNYPAQGYPPSGYPSSGYPPAGYKK 257 [34][TOP] >UniRef100_Q6QE84 Rhodopsin (Fragment) n=1 Tax=Loligo forbesi RepID=Q6QE84_LOLFO Length = 305 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 3/41 (7%) Frame = -2 Query: 404 QPAPYGQPYGYPPA---PPPAQGYPATGYPPAAYPPPGYPP 291 Q P P GYPP PPP QGYP GYPP YPP GYPP Sbjct: 245 QQQPAYPPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPP 285 [35][TOP] >UniRef100_Q3BDP0 Rhodopsin (Fragment) n=1 Tax=Photololigo sp. JMS-2004 RepID=Q3BDP0_9MOLL Length = 305 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 3/41 (7%) Frame = -2 Query: 404 QPAPYGQPYGYPPA---PPPAQGYPATGYPPAAYPPPGYPP 291 Q P P GYPP PPP QGYP GYPP YPP GYPP Sbjct: 245 QQQPAYPPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPP 285 [36][TOP] >UniRef100_Q17094 Rhodopsin (Fragment) n=1 Tax=Alloteuthis subulata RepID=OPSD_LOLSU Length = 439 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 3/41 (7%) Frame = -2 Query: 404 QPAPYGQPYGYPPA---PPPAQGYPATGYPPAAYPPPGYPP 291 Q P P GYPP PPP QGYP GYPP YPP GYPP Sbjct: 378 QQQPAYPPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPP 418 [37][TOP] >UniRef100_P24603 Rhodopsin n=1 Tax=Loligo forbesi RepID=OPSD_LOLFO Length = 452 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 3/41 (7%) Frame = -2 Query: 404 QPAPYGQPYGYPPA---PPPAQGYPATGYPPAAYPPPGYPP 291 Q P P GYPP PPP QGYP GYPP YPP GYPP Sbjct: 385 QQQPAYPPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPP 425 [38][TOP] >UniRef100_Q6QE83 Rhodopsin (Fragment) n=1 Tax=Sthenoteuthis oualaniensis RepID=Q6QE83_9MOLL Length = 295 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/44 (56%), Positives = 27/44 (61%), Gaps = 2/44 (4%) Frame = -2 Query: 407 PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPP--GYPPSGY 282 P P Y P GYPP P QGYP GYPP YPPP G PP+G+ Sbjct: 239 PPPQGYPPPQGYPPQGYPPQGYPPQGYPPQGYPPPPQGPPPAGW 282 [39][TOP] >UniRef100_Q3BDP4 Rhodopsin (Fragment) n=1 Tax=Ommastrephes bartramii RepID=Q3BDP4_9MOLL Length = 296 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/38 (63%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Frame = -2 Query: 386 QPYGYPPAPP---PAQGYPATGYPPAAYPPPGYPPSGY 282 Q YPP PP P QGYP GYPP YPP GYPP GY Sbjct: 237 QQAAYPPPPPQGYPPQGYPPQGYPPQGYPPQGYPPQGY 274 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/44 (59%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Frame = -2 Query: 407 PQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPP--GYPPSG 285 P P P G P GYPP P QGYP GYPP YPPP G PP G Sbjct: 242 PPPPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPPPQGPPPQG 285 [40][TOP] >UniRef100_C0IN06 Proline-rich family protein n=1 Tax=Cicer arietinum RepID=C0IN06_CICAR Length = 186 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/43 (58%), Positives = 28/43 (65%), Gaps = 3/43 (6%) Frame = -2 Query: 401 PAPYGQPYGYPPAP--PPAQGYPATGYPPA-AYPPPGYPPSGY 282 P Y +GYPP PP QGYP +GYPP YPP GYPP+GY Sbjct: 37 PGAYPPQHGYPPQQGYPPQQGYPPSGYPPQQGYPPQGYPPAGY 79 [41][TOP] >UniRef100_Q3BDP7 Rhodopsin (Fragment) n=1 Tax=Bathyteuthis berryi RepID=Q3BDP7_9MOLL Length = 267 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/37 (64%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = -2 Query: 395 PYGQPYGYPPA--PPPAQGYPATGYPPAAYPPPGYPP 291 P P GYPP PPP QGYP GYPP YPP GYPP Sbjct: 231 PAYPPQGYPPQGYPPPPQGYPPQGYPPQGYPPQGYPP 267 [42][TOP] >UniRef100_Q0D322 Rhodopsin (Fragment) n=1 Tax=Histioteuthis oceanica RepID=Q0D322_9MOLL Length = 299 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/43 (58%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = -2 Query: 407 PQPAPYGQPYGYPPA--PPPAQGYPATGYPPAAYPPPGYPPSG 285 P P P GYPP PPP QGYP GYPP YPP G PP G Sbjct: 246 PPPQQGYPPQGYPPQGYPPPPQGYPPQGYPPQGYPPQGAPPQG 288 [43][TOP] >UniRef100_B4N6T9 GK24096 n=1 Tax=Drosophila willistoni RepID=B4N6T9_DROWI Length = 536 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/44 (61%), Positives = 28/44 (63%), Gaps = 4/44 (9%) Frame = -2 Query: 407 PQPAPYGQP---YGYPPAPPPAQGY-PATGYPPAAYPPPGYPPS 288 PQ Y P YGYPP PPP QGY PA GYPP AY PP PP+ Sbjct: 30 PQYEGYAPPPPQYGYPPQPPPGQGYPPAAGYPPQAYAPPQPPPN 73 [44][TOP] >UniRef100_UPI00003BE83A hypothetical protein DEHA0G23474g n=1 Tax=Debaryomyces hansenii CBS767 RepID=UPI00003BE83A Length = 440 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/46 (54%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = -2 Query: 407 PQPAPYGQ---PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYS 279 P P GQ P GYPP P QGYP GY P YPP GY P GY+ Sbjct: 27 PPPGAQGQYPPPQGYPPQGYPPQGYPPQGYAPQGYPPQGYAPQGYA 72 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/46 (54%), Positives = 25/46 (54%), Gaps = 4/46 (8%) Frame = -2 Query: 407 PQPAPYGQPYGYPPAP----PPAQGYPATGYPPAAYPPPGYPPSGY 282 P P G YG PP PP QGYP GYPP YPP GY P GY Sbjct: 16 PPGPPNGYQYGPPPGAQGQYPPPQGYPPQGYPPQGYPPQGYAPQGY 61 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/45 (57%), Positives = 27/45 (60%), Gaps = 3/45 (6%) Frame = -2 Query: 404 QPAPYGQPYGYPPAPPP-AQGY--PATGYPPAAYPPPGYPPSGYS 279 Q P G P GY PPP AQG P GYPP YPP GYPP GY+ Sbjct: 13 QAPPPGPPNGYQYGPPPGAQGQYPPPQGYPPQGYPPQGYPPQGYA 57 [45][TOP] >UniRef100_Q3BDN7 Rhodopsin (Fragment) n=1 Tax=Heteroteuthis hawaiiensis RepID=Q3BDN7_9MOLL Length = 294 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 3/40 (7%) Frame = -2 Query: 395 PYGQPYGYPPA--PPPAQGYPATGYPP-AAYPPPGYPPSG 285 P P GYPP PPP QGYP GYPP AYPP GYPP G Sbjct: 239 PAYPPQGYPPQGYPPPPQGYPPQGYPPQGAYPPQGYPPQG 278 [46][TOP] >UniRef100_Q0D324 Rhodopsin (Fragment) n=1 Tax=Onychoteuthis sp. B3-JMS-2004 RepID=Q0D324_9MOLL Length = 303 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -2 Query: 383 PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 285 P GYPP P QGYP GYPP YPP GYPP G Sbjct: 255 PQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQG 287 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/41 (58%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = -2 Query: 398 APYGQPYGYPPAPP--PAQGYPATGYPPAAYPPPGYPPSGY 282 A Q YPP P P QGYP GYPP YPP GYPP GY Sbjct: 243 AQQAQQAAYPPPPQGYPPQGYPPQGYPPQGYPPQGYPPQGY 283 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/40 (60%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = -2 Query: 401 PAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 285 P P G P GYPP P QGYP GYPP YPP G PP G Sbjct: 253 PPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGAPPQG 292 [47][TOP] >UniRef100_Q6BH13 Metacaspase-1 n=1 Tax=Debaryomyces hansenii RepID=MCA1_DEBHA Length = 440 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/46 (54%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = -2 Query: 407 PQPAPYGQ---PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYS 279 P P GQ P GYPP P QGYP GY P YPP GY P GY+ Sbjct: 27 PPPGAQGQYPPPQGYPPQGYPPQGYPPQGYAPQGYPPQGYAPQGYA 72 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/46 (54%), Positives = 25/46 (54%), Gaps = 4/46 (8%) Frame = -2 Query: 407 PQPAPYGQPYGYPPAP----PPAQGYPATGYPPAAYPPPGYPPSGY 282 P P G YG PP PP QGYP GYPP YPP GY P GY Sbjct: 16 PPGPPNGYQYGPPPGAQGQYPPPQGYPPQGYPPQGYPPQGYAPQGY 61 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/45 (57%), Positives = 27/45 (60%), Gaps = 3/45 (6%) Frame = -2 Query: 404 QPAPYGQPYGYPPAPPP-AQGY--PATGYPPAAYPPPGYPPSGYS 279 Q P G P GY PPP AQG P GYPP YPP GYPP GY+ Sbjct: 13 QAPPPGPPNGYQYGPPPGAQGQYPPPQGYPPQGYPPQGYPPQGYA 57 [48][TOP] >UniRef100_UPI0000D57386 PREDICTED: similar to phospholipid scramblase 1, putative n=1 Tax=Tribolium castaneum RepID=UPI0000D57386 Length = 214 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/45 (57%), Positives = 27/45 (60%), Gaps = 5/45 (11%) Frame = -2 Query: 401 PAPYGQPYGYPP----APPPAQGYPATGYPPAAYPPPG-YPPSGY 282 P P GQ YG PP PPP G P GYPP YPPPG YPP G+ Sbjct: 24 PMPPGQGYGTPPPPGYGPPPGYGPPPQGYPPGQYPPPGQYPPPGH 68 [49][TOP] >UniRef100_A9P8I3 Predicted protein n=1 Tax=Populus trichocarpa RepID=A9P8I3_POPTR Length = 125 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/44 (56%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Frame = -2 Query: 401 PAPYGQPY---GYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYS 279 P+ Y PY GYPP PP GYP T P YPPPG PP GYS Sbjct: 13 PSGYSPPYPPPGYPPTTPPYGGYPPTTPPYGGYPPPGAPPPGYS 56 [50][TOP] >UniRef100_B9I6F5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9I6F5_POPTR Length = 192 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/33 (75%), Positives = 25/33 (75%), Gaps = 2/33 (6%) Frame = -2 Query: 374 YPP-APPPAQGYPATGYPPAAYPPP-GYPPSGY 282 YPP AP P GYP GYPPA YPPP GYPPSGY Sbjct: 29 YPPSAPYPPHGYPQQGYPPAGYPPPGGYPPSGY 61 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/44 (59%), Positives = 29/44 (65%), Gaps = 2/44 (4%) Frame = -2 Query: 407 PQPAPYGQPYGYPPAPPPAQGYPATG-YPPAAYPPPG-YPPSGY 282 P APY P+GYP P GYP G YPP+ YPPPG YPP+GY Sbjct: 30 PPSAPY-PPHGYPQQGYPPAGYPPPGGYPPSGYPPPGGYPPAGY 72 [51][TOP] >UniRef100_A5PLE2 UPF0467 protein C5orf32 homolog n=1 Tax=Danio rerio RepID=CE032_DANRE Length = 118 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = -2 Query: 407 PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 282 P PAP GYP P QGYPA GYPP YP GYP GY Sbjct: 12 PGPAPGYPAQGYPAQGYPTQGYPAQGYPPQGYPAQGYPAQGY 53 [52][TOP] >UniRef100_C6T3K1 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T3K1_SOYBN Length = 183 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/59 (45%), Positives = 29/59 (49%), Gaps = 17/59 (28%) Frame = -2 Query: 407 PQPAPYGQPYGYPPAP-PPAQGYPATGYPPAAYPPPGY----------------PPSGY 282 P PY P+GYPP+ PP GYP T YPP AYPPPG PP GY Sbjct: 24 PSAPPYPPPHGYPPSGYPPPGGYPPTAYPPPAYPPPGVYPHSGYYPSEYPPAYPPPGGY 82 [53][TOP] >UniRef100_A7PSK5 Chromosome chr6 scaffold_28, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7PSK5_VITVI Length = 191 Score = 55.1 bits (131), Expect = 2e-06 Identities = 28/48 (58%), Positives = 30/48 (62%), Gaps = 8/48 (16%) Frame = -2 Query: 401 PAPYGQPYGYPPAP-PPAQGYPATGYPP------AAYPPP-GYPPSGY 282 P+ Y P GYPP+ PP GYP GYPP A YPPP GYPPSGY Sbjct: 54 PSGYPPPGGYPPSGYPPPGGYPPAGYPPPGGYPPAPYPPPGGYPPSGY 101 [54][TOP] >UniRef100_P31356 Rhodopsin n=1 Tax=Todarodes pacificus RepID=OPSD_TODPA Length = 448 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/38 (65%), Positives = 25/38 (65%), Gaps = 3/38 (7%) Frame = -2 Query: 386 QPYGYPP---APPPAQGYPATGYPPAAYPPPGYPPSGY 282 Q YPP APPP QGYP GYPP YPP GYPP GY Sbjct: 384 QQAAYPPQGYAPPP-QGYPPQGYPPQGYPPQGYPPQGY 420 [55][TOP] >UniRef100_Q3BDP3 Rhodopsin (Fragment) n=1 Tax=Lolliguncula brevis RepID=Q3BDP3_9MOLL Length = 296 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/42 (64%), Positives = 27/42 (64%), Gaps = 4/42 (9%) Frame = -2 Query: 404 QPAPYGQPYGYPPA---PPPAQGYPATGYPPA-AYPPPGYPP 291 QPA Y P GYPP PPP QGYP GYPP YPP GYPP Sbjct: 247 QPA-YPPPQGYPPQGYPPPPPQGYPPQGYPPPQGYPPQGYPP 287 [56][TOP] >UniRef100_B4YS71 Rhodopsin (Fragment) n=1 Tax=Alloteuthis africana RepID=B4YS71_9MOLL Length = 303 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/42 (64%), Positives = 27/42 (64%), Gaps = 4/42 (9%) Frame = -2 Query: 404 QPAPYGQPYGYPPA---PPPAQGYPATGYPPA-AYPPPGYPP 291 QPA Y P GYPP PPP QGYP GYPP YPP GYPP Sbjct: 247 QPA-YPPPQGYPPQGYPPPPPQGYPPQGYPPPQGYPPQGYPP 287 [57][TOP] >UniRef100_Q3BDN8 Rhodopsin (Fragment) n=1 Tax=Rossia pacifica RepID=Q3BDN8_ROSPA Length = 305 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/38 (65%), Positives = 25/38 (65%), Gaps = 3/38 (7%) Frame = -2 Query: 395 PYGQPYGYPPA--PPPAQGYPATGYPP-AAYPPPGYPP 291 P P GYPP PPP QGYP GYPP AYPP GYPP Sbjct: 249 PAYPPQGYPPQGYPPPPQGYPPQGYPPQGAYPPQGYPP 286 [58][TOP] >UniRef100_Q0D326 Rhodopsin (Fragment) n=2 Tax=Euprymna RepID=Q0D326_9MOLL Length = 298 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 3/41 (7%) Frame = -2 Query: 404 QPAPYGQPYGYPPA--PPPAQGYPATGYPP-AAYPPPGYPP 291 Q A Y P GYPP PPP QGYP GYPP AYPP GYPP Sbjct: 248 QQAAY-PPQGYPPQGYPPPPQGYPPQGYPPQGAYPPQGYPP 287 [59][TOP] >UniRef100_B8Q2W3 Opsin n=1 Tax=Euprymna scolopes RepID=B8Q2W3_9MOLL Length = 448 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 3/41 (7%) Frame = -2 Query: 404 QPAPYGQPYGYPPA--PPPAQGYPATGYPP-AAYPPPGYPP 291 Q A Y P GYPP PPP QGYP GYPP AYPP GYPP Sbjct: 388 QQAAY-PPQGYPPQGYPPPPQGYPPQGYPPQGAYPPQGYPP 427 [60][TOP] >UniRef100_B8Q2W2 Opsin n=1 Tax=Euprymna scolopes RepID=B8Q2W2_9MOLL Length = 448 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 3/41 (7%) Frame = -2 Query: 404 QPAPYGQPYGYPPA--PPPAQGYPATGYPP-AAYPPPGYPP 291 Q A Y P GYPP PPP QGYP GYPP AYPP GYPP Sbjct: 388 QQAAY-PPQGYPPQGYPPPPQGYPPQGYPPQGAYPPQGYPP 427 [61][TOP] >UniRef100_B6SHN0 Adhesive/proline-rich protein n=1 Tax=Zea mays RepID=B6SHN0_MAIZE Length = 93 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/33 (69%), Positives = 23/33 (69%), Gaps = 2/33 (6%) Frame = -2 Query: 383 PYGYPPA--PPPAQGYPATGYPPAAYPPPGYPP 291 P GYPPA PPPAQGYP GYP YP GYPP Sbjct: 26 PAGYPPAGYPPPAQGYPPQGYPQQGYPQQGYPP 58 [62][TOP] >UniRef100_A9NLR5 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NLR5_PICSI Length = 95 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -2 Query: 371 PPAPPPAQGYPATGYPPAAYPPPGYPPSGY 282 P PP QGYP GYP AYPPPGYPP GY Sbjct: 10 PVGVPPPQGYPPEGYPKDAYPPPGYPPQGY 39 [63][TOP] >UniRef100_Q0D312 Rhodopsin (Fragment) n=1 Tax=Todaropsis eblanae RepID=Q0D312_9MOLL Length = 300 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/39 (58%), Positives = 23/39 (58%), Gaps = 4/39 (10%) Frame = -2 Query: 386 QPYGYPPA----PPPAQGYPATGYPPAAYPPPGYPPSGY 282 Q YPP PPP QGYP GYPP YP GYPP GY Sbjct: 244 QQAAYPPQGYAQPPPPQGYPPQGYPPQGYPQQGYPPQGY 282 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -2 Query: 404 QPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPP-GYPPSG 285 QP P P GYPP P QGYP GYPP YPPP G PP G Sbjct: 255 QPPP---PQGYPPQGYPPQGYPQQGYPPQGYPPPQGAPPQG 292 [64][TOP] >UniRef100_B4YS88 Rhodopsin (Fragment) n=1 Tax=Alloteuthis media RepID=B4YS88_9MOLL Length = 309 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 2/43 (4%) Frame = -2 Query: 404 QPAPYGQPYGYPPA--PPPAQGYPATGYPPAAYPPPGYPPSGY 282 QPA Y P GYPP PPP QGYP GYPP P GYPP GY Sbjct: 247 QPA-YPPPQGYPPQGYPPPPQGYPPQGYPP----PQGYPPQGY 284 [65][TOP] >UniRef100_Q32L53 Glutamate [NMDA] receptor-associated protein 1 n=1 Tax=Bos taurus RepID=GRINA_BOVIN Length = 366 Score = 53.9 bits (128), Expect = 5e-06 Identities = 29/53 (54%), Positives = 31/53 (58%), Gaps = 12/53 (22%) Frame = -2 Query: 404 QPAPYGQPYGYP--PAPPPAQGYPATGYPPAAYP----PPG------YPPSGY 282 QP+PYGQP GYP P+P P GYP YPP YP PPG YPP GY Sbjct: 43 QPSPYGQP-GYPQGPSPYPQGGYPQGPYPPGGYPQGPYPPGGYPQGPYPPGGY 94 [66][TOP] >UniRef100_C6SWT5 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6SWT5_SOYBN Length = 170 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/44 (54%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = -2 Query: 407 PQPAPYGQPYGYPPAPPPAQGYPA-TGYPPAAYPPPGYPPSGYS 279 P P Y GYPPA P GYP GYPPA YPP GYP S ++ Sbjct: 41 PPPGAYPPQQGYPPAGYPPAGYPPHQGYPPAGYPPAGYPGSSHA 84 [67][TOP] >UniRef100_B9SDA8 Glycine-rich protein A3, putative n=1 Tax=Ricinus communis RepID=B9SDA8_RICCO Length = 177 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/46 (52%), Positives = 29/46 (63%), Gaps = 4/46 (8%) Frame = -2 Query: 401 PAPYGQ---PYGYPPAPPPAQGYPATGYP-PAAYPPPGYPPSGYSR 276 P+PYG P YPP+ PP + Y TG+P P YPP YPP+GY R Sbjct: 58 PSPYGYSSPPSAYPPSYPPQKPYGPTGFPSPGGYPPVAYPPAGYPR 103 [68][TOP] >UniRef100_A2XNE8 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2XNE8_ORYSI Length = 185 Score = 53.5 bits (127), Expect = 7e-06 Identities = 29/62 (46%), Positives = 30/62 (48%), Gaps = 22/62 (35%) Frame = -2 Query: 401 PAPYGQPYGYPPAPP----PAQGYPAT------------GYPPAAYPP------PGYPPS 288 P Y P GYP APP PA GYP GYPP AYPP PGYPP+ Sbjct: 39 PGQYPTPGGYPSAPPGQYPPADGYPGAQYPPGGYPPSQGGYPPGAYPPSGYPQQPGYPPA 98 Query: 287 GY 282 GY Sbjct: 99 GY 100 [69][TOP] >UniRef100_Q6QE96 Rhodopsin (Fragment) n=1 Tax=Octopus bimaculoides RepID=Q6QE96_OCTBM Length = 294 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/45 (62%), Positives = 28/45 (62%), Gaps = 4/45 (8%) Frame = -2 Query: 404 QPAPYGQP--YGYPPAPPPAQG-YPATGYPP-AAYPPPGYPPSGY 282 Q A Y QP GYPP P QG YP GYPP AYPP GYPP GY Sbjct: 243 QQAAYQQPPPQGYPPQGYPPQGAYPPQGYPPQGAYPPQGYPPQGY 287 [70][TOP] >UniRef100_B5DPT7 GA23811 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DPT7_DROPS Length = 561 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/34 (61%), Positives = 21/34 (61%) Frame = -2 Query: 383 PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 282 P GYPP P QGYP GYPP YP GYP GY Sbjct: 18 PAGYPPQEYPPQGYPQQGYPPQGYPAQGYPQQGY 51 [71][TOP] >UniRef100_A2EVN2 XYPPX repeat family protein n=1 Tax=Trichomonas vaginalis G3 RepID=A2EVN2_TRIVA Length = 231 Score = 53.1 bits (126), Expect = 9e-06 Identities = 29/50 (58%), Positives = 29/50 (58%), Gaps = 9/50 (18%) Frame = -2 Query: 404 QPAPYGQPY--GYPPA--PP----PAQGYPATGYPPAAYPPPGYPP-SGY 282 QP P G P GYP A PP P QGYP GYPP YP PGYPP GY Sbjct: 131 QPRPQGYPPMGGYPQAGYPPQGGYPPQGYPQAGYPPQGYPQPGYPPQQGY 180 [72][TOP] >UniRef100_Q1DWE3 Putative uncharacterized protein n=1 Tax=Coccidioides immitis RepID=Q1DWE3_COCIM Length = 442 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/44 (56%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = -2 Query: 407 PQPAPYGQPYGYPPAPPPAQGYPATGY--PPAAYPPPGYPPSGY 282 P PA Y QP PP PP G P GY PP YPP GYPP GY Sbjct: 16 PNPA-YAQPGQQPPQQPPPHGAPPQGYYPPPQGYPPQGYPPQGY 58 [73][TOP] >UniRef100_C5PBW6 XYPPX repeat family protein n=1 Tax=Coccidioides posadasii C735 delta SOWgp RepID=C5PBW6_COCP7 Length = 442 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/44 (56%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = -2 Query: 407 PQPAPYGQPYGYPPAPPPAQGYPATGY--PPAAYPPPGYPPSGY 282 P PA Y QP PP PP G P GY PP YPP GYPP GY Sbjct: 16 PNPA-YAQPGQQPPQQPPPHGAPPQGYYPPPQGYPPQGYPPQGY 58