[UP]
[1][TOP] >UniRef100_UPI00019847F1 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI00019847F1 Length = 145 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 107 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 145 [2][TOP] >UniRef100_UPI0001983659 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001983659 Length = 146 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 108 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 146 [3][TOP] >UniRef100_UPI0001983658 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001983658 Length = 147 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 109 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 147 [4][TOP] >UniRef100_UPI0001983657 PREDICTED: hypothetical protein isoform 2 n=1 Tax=Vitis vinifera RepID=UPI0001983657 Length = 132 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 94 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 132 [5][TOP] >UniRef100_UPI0001983656 PREDICTED: hypothetical protein isoform 3 n=1 Tax=Vitis vinifera RepID=UPI0001983656 Length = 136 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 98 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 136 [6][TOP] >UniRef100_UPI0001983655 PREDICTED: hypothetical protein isoform 1 n=1 Tax=Vitis vinifera RepID=UPI0001983655 Length = 148 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 110 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 148 [7][TOP] >UniRef100_UPI000198363A PREDICTED: similar to Histone H2B isoform 2 n=1 Tax=Vitis vinifera RepID=UPI000198363A Length = 131 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 93 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 131 [8][TOP] >UniRef100_UPI0001983639 PREDICTED: similar to Histone H2B isoform 3 n=1 Tax=Vitis vinifera RepID=UPI0001983639 Length = 137 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 99 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 137 [9][TOP] >UniRef100_Q9M3H6 Histone H2B n=1 Tax=Cicer arietinum RepID=Q9M3H6_CICAR Length = 139 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 101 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 139 [10][TOP] >UniRef100_Q2XPW1 Histone H2B n=1 Tax=Solanum tuberosum RepID=Q2XPW1_SOLTU Length = 146 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 108 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 146 [11][TOP] >UniRef100_Q0WS75 Histone H2B n=1 Tax=Arabidopsis thaliana RepID=Q0WS75_ARATH Length = 145 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 107 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 145 [12][TOP] >UniRef100_C6T571 Histone H2B n=1 Tax=Glycine max RepID=C6T571_SOYBN Length = 119 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 81 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 119 [13][TOP] >UniRef100_C6T1C4 Histone H2B n=1 Tax=Glycine max RepID=C6T1C4_SOYBN Length = 138 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 100 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 138 [14][TOP] >UniRef100_C6SWY5 Histone H2B n=1 Tax=Glycine max RepID=C6SWY5_SOYBN Length = 148 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 110 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 148 [15][TOP] >UniRef100_C6SWE9 Histone H2B n=1 Tax=Glycine max RepID=C6SWE9_SOYBN Length = 137 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 99 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 137 [16][TOP] >UniRef100_B9T761 Histone H2B n=1 Tax=Ricinus communis RepID=B9T761_RICCO Length = 135 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 97 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 135 [17][TOP] >UniRef100_B9T302 Histone H2B n=1 Tax=Ricinus communis RepID=B9T302_RICCO Length = 141 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 103 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 141 [18][TOP] >UniRef100_B9T301 Histone H2B n=1 Tax=Ricinus communis RepID=B9T301_RICCO Length = 141 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 103 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 141 [19][TOP] >UniRef100_B9SCL5 Histone H2B n=1 Tax=Ricinus communis RepID=B9SCL5_RICCO Length = 141 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 103 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 141 [20][TOP] >UniRef100_B9HUW2 Histone H2B (Fragment) n=4 Tax=Magnoliophyta RepID=B9HUW2_POPTR Length = 93 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 55 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 93 [21][TOP] >UniRef100_B9HUV8 Histone H2B n=1 Tax=Populus trichocarpa RepID=B9HUV8_POPTR Length = 140 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 102 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 140 [22][TOP] >UniRef100_B9HUV6 Histone H2B n=1 Tax=Populus trichocarpa RepID=B9HUV6_POPTR Length = 140 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 102 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 140 [23][TOP] >UniRef100_B9H369 Histone H2B (Fragment) n=1 Tax=Populus trichocarpa RepID=B9H369_POPTR Length = 93 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 55 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 93 [24][TOP] >UniRef100_B7FHC9 Histone H2B n=1 Tax=Medicago truncatula RepID=B7FHC9_MEDTR Length = 148 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 110 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 148 [25][TOP] >UniRef100_B3SGL7 Histone H2B n=1 Tax=Medicago truncatula RepID=B3SGL7_MEDTR Length = 137 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 99 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 137 [26][TOP] >UniRef100_B9GV78 Histone H2B n=2 Tax=Populus RepID=B9GV78_POPTR Length = 148 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 110 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 148 [27][TOP] >UniRef100_A9PJP4 Histone H2B n=1 Tax=Populus trichocarpa x Populus deltoides RepID=A9PJP4_9ROSI Length = 139 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 101 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 139 [28][TOP] >UniRef100_A9PDD5 Histone H2B n=1 Tax=Populus trichocarpa RepID=A9PDD5_POPTR Length = 143 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 105 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 143 [29][TOP] >UniRef100_A9PCC8 Histone H2B n=1 Tax=Populus trichocarpa RepID=A9PCC8_POPTR Length = 139 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 101 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 139 [30][TOP] >UniRef100_A9PC90 Histone H2B n=1 Tax=Populus trichocarpa RepID=A9PC90_POPTR Length = 139 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 101 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 139 [31][TOP] >UniRef100_A9P8Q5 Histone H2B n=1 Tax=Populus trichocarpa RepID=A9P8Q5_POPTR Length = 139 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 101 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 139 [32][TOP] >UniRef100_A8J6V0 Histone H2B n=1 Tax=Nicotiana tabacum RepID=A8J6V0_TOBAC Length = 141 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 103 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 141 [33][TOP] >UniRef100_A7PHV6 Histone H2B n=1 Tax=Vitis vinifera RepID=A7PHV6_VITVI Length = 150 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 112 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 150 [34][TOP] >UniRef100_A7NZ60 Histone H2B n=1 Tax=Vitis vinifera RepID=A7NZ60_VITVI Length = 137 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 99 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 137 [35][TOP] >UniRef100_A7NZ59 Histone H2B n=1 Tax=Vitis vinifera RepID=A7NZ59_VITVI Length = 210 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 172 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 210 [36][TOP] >UniRef100_A7NZ58 Histone H2B n=1 Tax=Vitis vinifera RepID=A7NZ58_VITVI Length = 151 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 113 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 151 [37][TOP] >UniRef100_A5BXF9 Histone H2B n=1 Tax=Vitis vinifera RepID=A5BXF9_VITVI Length = 145 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 107 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 145 [38][TOP] >UniRef100_A5BCC0 Histone H2B n=1 Tax=Vitis vinifera RepID=A5BCC0_VITVI Length = 152 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 114 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 152 [39][TOP] >UniRef100_A5AWB0 Histone H2B n=1 Tax=Vitis vinifera RepID=A5AWB0_VITVI Length = 145 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 107 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 145 [40][TOP] >UniRef100_A2IBL2 Histone H2B n=1 Tax=Nicotiana benthamiana RepID=A2IBL2_NICBE Length = 147 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 109 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 147 [41][TOP] >UniRef100_O22582 Histone H2B n=1 Tax=Gossypium hirsutum RepID=H2B_GOSHI Length = 147 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 109 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 147 [42][TOP] >UniRef100_O49118 Histone H2B n=1 Tax=Capsicum annuum RepID=H2B_CAPAN Length = 145 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 107 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 145 [43][TOP] >UniRef100_Q9LZ45 Histone H2B.9 n=1 Tax=Arabidopsis thaliana RepID=H2B9_ARATH Length = 132 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 94 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 132 [44][TOP] >UniRef100_Q9LGH8 Histone H2B.8 n=2 Tax=Oryza sativa RepID=H2B8_ORYSJ Length = 153 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 115 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 153 [45][TOP] >UniRef100_Q9LZT0 Histone H2B.7 n=2 Tax=Arabidopsis thaliana RepID=H2B7_ARATH Length = 145 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 107 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 145 [46][TOP] >UniRef100_Q9LGH4 Histone H2B.6 n=1 Tax=Oryza sativa Japonica Group RepID=H2B6_ORYSJ Length = 153 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 115 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 153 [47][TOP] >UniRef100_A2WKT1 Histone H2B.6 n=1 Tax=Oryza sativa Indica Group RepID=H2B6_ORYSI Length = 153 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 115 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 153 [48][TOP] >UniRef100_O23629 Histone H2B.6 n=2 Tax=Arabidopsis thaliana RepID=H2B6_ARATH Length = 150 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 112 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 150 [49][TOP] >UniRef100_Q43216 Histone H2B.5 n=1 Tax=Triticum aestivum RepID=H2B5_WHEAT Length = 136 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 98 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 136 [50][TOP] >UniRef100_Q9SF55 Histone H2B.5 n=1 Tax=Arabidopsis thaliana RepID=H2B5_ARATH Length = 126 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 88 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 126 [51][TOP] >UniRef100_O65819 Histone H2B.3 (Fragment) n=1 Tax=Solanum lycopersicum RepID=H2B3_SOLLC Length = 137 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 99 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 137 [52][TOP] >UniRef100_Q1SU99 Probable histone H2B.3 n=2 Tax=Medicago truncatula RepID=H2B3_MEDTR Length = 138 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 100 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 138 [53][TOP] >UniRef100_Q9SI96 Histone H2B.3 n=1 Tax=Arabidopsis thaliana RepID=H2B3_ARATH Length = 151 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 113 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 151 [54][TOP] >UniRef100_O65818 Histone H2B.2 n=1 Tax=Solanum lycopersicum RepID=H2B2_SOLLC Length = 140 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 102 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 140 [55][TOP] >UniRef100_Q1S9I9 Probable histone H2B.1 n=1 Tax=Medicago truncatula RepID=H2B1_MEDTR Length = 148 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 110 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 148 [56][TOP] >UniRef100_Q9LQQ4 Histone H2B.1 n=1 Tax=Arabidopsis thaliana RepID=H2B1_ARATH Length = 148 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 110 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 148 [57][TOP] >UniRef100_P40283 Histone H2B.11 n=2 Tax=Arabidopsis thaliana RepID=H2B11_ARATH Length = 150 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 112 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 150 [58][TOP] >UniRef100_Q9FFC0 Histone H2B.10 n=2 Tax=Arabidopsis thaliana RepID=H2B10_ARATH Length = 145 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 107 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 145 [59][TOP] >UniRef100_A9TC10 Histone H2B n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TC10_PHYPA Length = 135 Score = 76.6 bits (187), Expect = 8e-13 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRL+LPGELAKHAVSEGTKAVTKFTSS Sbjct: 97 KPTITSREIQTAVRLILPGELAKHAVSEGTKAVTKFTSS 135 [60][TOP] >UniRef100_UPI0000DD957D Os08g0490900 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000DD957D Length = 368 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 330 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 368 [61][TOP] >UniRef100_Q94KK3 Histone H2B (Fragment) n=1 Tax=Lolium perenne RepID=Q94KK3_LOLPR Length = 70 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 32 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 70 [62][TOP] >UniRef100_Q6L507 Histone H2B n=1 Tax=Oryza sativa Japonica Group RepID=Q6L507_ORYSJ Length = 124 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 86 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 124 [63][TOP] >UniRef100_Q43724 Histone H2B (Fragment) n=1 Tax=Asparagus officinalis RepID=Q43724_ASPOF Length = 152 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 114 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 152 [64][TOP] >UniRef100_Q2XTD8 Histone H2B n=1 Tax=Solanum tuberosum RepID=Q2XTD8_SOLTU Length = 143 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS+ Sbjct: 105 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSN 143 [65][TOP] >UniRef100_Q0DHK3 Histone H2B n=1 Tax=Oryza sativa Japonica Group RepID=Q0DHK3_ORYSJ Length = 118 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 80 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 118 [66][TOP] >UniRef100_O65006 Histone H2B (Fragment) n=1 Tax=Malus x domestica RepID=O65006_MALDO Length = 93 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 55 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 93 [67][TOP] >UniRef100_C5YM38 Histone H2B n=1 Tax=Sorghum bicolor RepID=C5YM38_SORBI Length = 151 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 113 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 151 [68][TOP] >UniRef100_C5YJD0 Histone H2B n=1 Tax=Sorghum bicolor RepID=C5YJD0_SORBI Length = 152 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 114 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 152 [69][TOP] >UniRef100_C5Y096 Histone H2B n=1 Tax=Sorghum bicolor RepID=C5Y096_SORBI Length = 155 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 117 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 155 [70][TOP] >UniRef100_C5XPF6 Histone H2B n=1 Tax=Sorghum bicolor RepID=C5XPF6_SORBI Length = 153 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 115 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 153 [71][TOP] >UniRef100_C5XPC7 Histone H2B n=1 Tax=Sorghum bicolor RepID=C5XPC7_SORBI Length = 149 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 111 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 149 [72][TOP] >UniRef100_C5XPC6 Histone H2B n=1 Tax=Sorghum bicolor RepID=C5XPC6_SORBI Length = 149 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 111 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 149 [73][TOP] >UniRef100_C5XP45 Histone H2B n=1 Tax=Sorghum bicolor RepID=C5XP45_SORBI Length = 137 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 99 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 137 [74][TOP] >UniRef100_C5XE66 Histone H2B n=1 Tax=Sorghum bicolor RepID=C5XE66_SORBI Length = 150 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 112 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 150 [75][TOP] >UniRef100_C5XDK0 Histone H2B n=1 Tax=Sorghum bicolor RepID=C5XDK0_SORBI Length = 153 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 115 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 153 [76][TOP] >UniRef100_C5X4Q7 Histone H2B n=1 Tax=Sorghum bicolor RepID=C5X4Q7_SORBI Length = 151 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 113 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 151 [77][TOP] >UniRef100_C4J4M8 Histone H2B n=1 Tax=Zea mays RepID=C4J4M8_MAIZE Length = 149 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 111 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 149 [78][TOP] >UniRef100_B9FKL6 Histone H2B n=1 Tax=Oryza sativa Japonica Group RepID=B9FKL6_ORYSJ Length = 95 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 57 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 95 [79][TOP] >UniRef100_B8AZ01 Histone H2B n=1 Tax=Oryza sativa Indica Group RepID=B8AZ01_ORYSI Length = 95 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 57 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 95 [80][TOP] >UniRef100_B6U9C5 Histone H2B n=1 Tax=Zea mays RepID=B6U9C5_MAIZE Length = 125 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 87 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 125 [81][TOP] >UniRef100_B6T878 Histone H2B n=1 Tax=Zea mays RepID=B6T878_MAIZE Length = 152 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 114 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 152 [82][TOP] >UniRef100_B6T1U2 Histone H2B n=1 Tax=Zea mays RepID=B6T1U2_MAIZE Length = 154 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 116 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 154 [83][TOP] >UniRef100_B6T1P2 Histone H2B n=1 Tax=Zea mays RepID=B6T1P2_MAIZE Length = 66 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 28 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 66 [84][TOP] >UniRef100_B6T1G5 Histone H2B n=1 Tax=Zea mays RepID=B6T1G5_MAIZE Length = 149 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 111 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 149 [85][TOP] >UniRef100_B6SJZ5 Histone H2B n=1 Tax=Zea mays RepID=B6SJZ5_MAIZE Length = 150 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 112 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 150 [86][TOP] >UniRef100_B4FXA3 Histone H2B n=1 Tax=Zea mays RepID=B4FXA3_MAIZE Length = 137 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 99 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 137 [87][TOP] >UniRef100_B4FCM8 Histone H2B n=1 Tax=Zea mays RepID=B4FCM8_MAIZE Length = 150 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 112 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 150 [88][TOP] >UniRef100_Q9LFF6 Histone H2B.8 n=1 Tax=Arabidopsis thaliana RepID=H2B8_ARATH Length = 138 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGEL+KHAVSEGTKAVTKFTSS Sbjct: 100 KPTITSREIQTAVRLVLPGELSKHAVSEGTKAVTKFTSS 138 [89][TOP] >UniRef100_P54348 Histone H2B.5 n=2 Tax=Zea mays RepID=H2B5_MAIZE Length = 154 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 116 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 154 [90][TOP] >UniRef100_P49120 Histone H2B.4 n=2 Tax=Zea mays RepID=H2B4_MAIZE Length = 137 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 99 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 137 [91][TOP] >UniRef100_P05621 Histone H2B.2 n=1 Tax=Triticum aestivum RepID=H2B2_WHEAT Length = 150 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 112 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 150 [92][TOP] >UniRef100_Q6ZBP3 Histone H2B.2 n=2 Tax=Oryza sativa RepID=H2B2_ORYSJ Length = 150 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 112 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 150 [93][TOP] >UniRef100_P30756 Histone H2B.2 n=2 Tax=Zea mays RepID=H2B2_MAIZE Length = 150 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 112 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 150 [94][TOP] >UniRef100_P27807 Histone H2B.1 n=1 Tax=Triticum aestivum RepID=H2B1_WHEAT Length = 152 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 114 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 152 [95][TOP] >UniRef100_O65821 Histone H2B.1 n=1 Tax=Solanum lycopersicum RepID=H2B1_SOLLC Length = 142 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS+ Sbjct: 104 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSN 142 [96][TOP] >UniRef100_P30755 Histone H2B.1 n=2 Tax=Zea mays RepID=H2B1_MAIZE Length = 151 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 113 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 151 [97][TOP] >UniRef100_Q943L2 Histone H2B.11 n=2 Tax=Oryza sativa RepID=H2B11_ORYSJ Length = 139 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 101 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 139 [98][TOP] >UniRef100_Q6ZXG9 Histone H2B (Fragment) n=1 Tax=Populus x canadensis RepID=Q6ZXG9_POPCA Length = 60 Score = 75.5 bits (184), Expect = 2e-12 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFT S Sbjct: 22 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTGS 60 [99][TOP] >UniRef100_C4J8G4 Histone H2B n=1 Tax=Zea mays RepID=C4J8G4_MAIZE Length = 66 Score = 75.5 bits (184), Expect = 2e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPT+TSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 28 KPTVTSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 66 [100][TOP] >UniRef100_B4FZQ6 Histone H2B n=1 Tax=Zea mays RepID=B4FZQ6_MAIZE Length = 152 Score = 75.5 bits (184), Expect = 2e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPT+TSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 114 KPTVTSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 152 [101][TOP] >UniRef100_A9STF4 Histone H2B n=1 Tax=Physcomitrella patens subsp. patens RepID=A9STF4_PHYPA Length = 136 Score = 75.5 bits (184), Expect = 2e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRL+LPGELAKHAVSEGTKAVTKFTS+ Sbjct: 98 KPTITSREIQTAVRLILPGELAKHAVSEGTKAVTKFTSA 136 [102][TOP] >UniRef100_A9SNM3 Histone H2B n=1 Tax=Physcomitrella patens subsp. patens RepID=A9SNM3_PHYPA Length = 136 Score = 75.5 bits (184), Expect = 2e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRL+LPGELAKHAVSEGTKAVTKFTS+ Sbjct: 98 KPTITSREIQTAVRLILPGELAKHAVSEGTKAVTKFTSA 136 [103][TOP] >UniRef100_A9SNM2 Histone H2B n=1 Tax=Physcomitrella patens subsp. patens RepID=A9SNM2_PHYPA Length = 138 Score = 75.5 bits (184), Expect = 2e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRL+LPGELAKHAVSEGTKAVTKFTS+ Sbjct: 100 KPTITSREIQTAVRLILPGELAKHAVSEGTKAVTKFTSA 138 [104][TOP] >UniRef100_A9SNM0 Histone H2B n=1 Tax=Physcomitrella patens subsp. patens RepID=A9SNM0_PHYPA Length = 136 Score = 75.5 bits (184), Expect = 2e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRL+LPGELAKHAVSEGTKAVTKFTS+ Sbjct: 98 KPTITSREIQTAVRLILPGELAKHAVSEGTKAVTKFTSA 136 [105][TOP] >UniRef100_A9S8R4 Histone H2B n=1 Tax=Physcomitrella patens subsp. patens RepID=A9S8R4_PHYPA Length = 135 Score = 75.5 bits (184), Expect = 2e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRL+LPGELAKHAVSEGTKAVTKFTS+ Sbjct: 97 KPTITSREIQTAVRLILPGELAKHAVSEGTKAVTKFTSA 135 [106][TOP] >UniRef100_A9RZD8 Histone H2B n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RZD8_PHYPA Length = 134 Score = 75.5 bits (184), Expect = 2e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRL+LPGELAKHAVSEGTKAVTKFTS+ Sbjct: 96 KPTITSREIQTAVRLILPGELAKHAVSEGTKAVTKFTSA 134 [107][TOP] >UniRef100_A9RXL7 Histone H2B n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RXL7_PHYPA Length = 136 Score = 75.5 bits (184), Expect = 2e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRL+LPGELAKHAVSEGTKAVTKFTS+ Sbjct: 98 KPTITSREIQTAVRLILPGELAKHAVSEGTKAVTKFTSA 136 [108][TOP] >UniRef100_P93354 Histone H2B n=1 Tax=Nicotiana tabacum RepID=H2B_TOBAC Length = 146 Score = 75.5 bits (184), Expect = 2e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTI+SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 108 KPTISSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 146 [109][TOP] >UniRef100_P16868 Histone H2B.4 n=1 Tax=Volvox carteri RepID=H2B4_VOLCA Length = 155 Score = 75.5 bits (184), Expect = 2e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPT+TSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS+ Sbjct: 117 KPTVTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 155 [110][TOP] >UniRef100_Q9ZUS0 Histone H2B.4 n=2 Tax=Arabidopsis thaliana RepID=H2B4_ARATH Length = 138 Score = 75.5 bits (184), Expect = 2e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 247 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS Sbjct: 101 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 138 [111][TOP] >UniRef100_P16867 Histone H2B.3 n=1 Tax=Volvox carteri RepID=H2B3_VOLCA Length = 157 Score = 75.5 bits (184), Expect = 2e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPT+TSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS+ Sbjct: 119 KPTVTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 157 [112][TOP] >UniRef100_Q43261 Histone H2B.3 n=1 Tax=Zea mays RepID=H2B3_MAIZE Length = 153 Score = 75.5 bits (184), Expect = 2e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPT+TSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 115 KPTVTSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 153 [113][TOP] >UniRef100_Q013K3 Histone H2B n=1 Tax=Ostreococcus tauri RepID=Q013K3_OSTTA Length = 125 Score = 75.1 bits (183), Expect = 2e-12 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPT+TSREIQTAVRL+LPGELAKHAVSEGTKAVTKFTS+ Sbjct: 87 KPTVTSREIQTAVRLILPGELAKHAVSEGTKAVTKFTSA 125 [114][TOP] >UniRef100_Q00Y53 Histone H2B n=1 Tax=Ostreococcus tauri RepID=Q00Y53_OSTTA Length = 138 Score = 75.1 bits (183), Expect = 2e-12 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPT+TSREIQTAVRL+LPGELAKHAVSEGTKAVTKFTS+ Sbjct: 100 KPTVTSREIQTAVRLILPGELAKHAVSEGTKAVTKFTSA 138 [115][TOP] >UniRef100_C1MHL2 Histone H2B n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MHL2_9CHLO Length = 116 Score = 75.1 bits (183), Expect = 2e-12 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPT+TSREIQTAVRL+LPGELAKHAVSEGTKAVTKFTS+ Sbjct: 78 KPTVTSREIQTAVRLILPGELAKHAVSEGTKAVTKFTSA 116 [116][TOP] >UniRef100_C1EAM8 Histone H2B n=1 Tax=Micromonas sp. RCC299 RepID=C1EAM8_9CHLO Length = 116 Score = 75.1 bits (183), Expect = 2e-12 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPT+TSREIQTAVRL+LPGELAKHAVSEGTKAVTKFTS+ Sbjct: 78 KPTVTSREIQTAVRLILPGELAKHAVSEGTKAVTKFTSN 116 [117][TOP] >UniRef100_C1E433 Histone H2B n=1 Tax=Micromonas sp. RCC299 RepID=C1E433_9CHLO Length = 116 Score = 75.1 bits (183), Expect = 2e-12 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPT+TSREIQTAVRL+LPGELAKHAVSEGTKAVTKFTS+ Sbjct: 78 KPTVTSREIQTAVRLILPGELAKHAVSEGTKAVTKFTSN 116 [118][TOP] >UniRef100_A8JJV5 Histone H2B (Fragment) n=2 Tax=Chlamydomonas reinhardtii RepID=A8JJV5_CHLRE Length = 104 Score = 75.1 bits (183), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 247 KPT+TSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS Sbjct: 66 KPTVTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 103 [119][TOP] >UniRef100_A8JJQ6 Histone H2B (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8JJQ6_CHLRE Length = 152 Score = 75.1 bits (183), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 247 KPT+TSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS Sbjct: 114 KPTVTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 151 [120][TOP] >UniRef100_A8JJN6 Histone H2B n=1 Tax=Chlamydomonas reinhardtii RepID=A8JJN6_CHLRE Length = 120 Score = 75.1 bits (183), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 247 KPT+TSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS Sbjct: 82 KPTVTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 119 [121][TOP] >UniRef100_A8JIN6 Histone H2B n=1 Tax=Chlamydomonas reinhardtii RepID=A8JIN6_CHLRE Length = 153 Score = 75.1 bits (183), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 247 KPT+TSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS Sbjct: 115 KPTVTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 152 [122][TOP] >UniRef100_A8JDH1 Histone H2B n=1 Tax=Chlamydomonas reinhardtii RepID=A8JDH1_CHLRE Length = 153 Score = 75.1 bits (183), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 247 KPT+TSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS Sbjct: 115 KPTVTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 152 [123][TOP] >UniRef100_A8JDE1 Histone H2B n=1 Tax=Chlamydomonas reinhardtii RepID=A8JDE1_CHLRE Length = 153 Score = 75.1 bits (183), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 247 KPT+TSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS Sbjct: 115 KPTVTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 152 [124][TOP] >UniRef100_A8JDC9 Histone H2B n=1 Tax=Chlamydomonas reinhardtii RepID=A8JDC9_CHLRE Length = 153 Score = 75.1 bits (183), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 247 KPT+TSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS Sbjct: 115 KPTVTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 152 [125][TOP] >UniRef100_A8JDC0 Histone H2B n=1 Tax=Chlamydomonas reinhardtii RepID=A8JDC0_CHLRE Length = 153 Score = 75.1 bits (183), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 247 KPT+TSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS Sbjct: 115 KPTVTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 152 [126][TOP] >UniRef100_A8JCT1 Histone H2B n=1 Tax=Chlamydomonas reinhardtii RepID=A8JCT1_CHLRE Length = 121 Score = 75.1 bits (183), Expect = 2e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPT+TSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS+ Sbjct: 83 KPTLTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTST 121 [127][TOP] >UniRef100_A8IW84 Histone H2B n=1 Tax=Chlamydomonas reinhardtii RepID=A8IW84_CHLRE Length = 155 Score = 75.1 bits (183), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 247 KPT+TSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS Sbjct: 117 KPTVTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 154 [128][TOP] >UniRef100_A8IW75 Histone H2B n=1 Tax=Chlamydomonas reinhardtii RepID=A8IW75_CHLRE Length = 155 Score = 75.1 bits (183), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 247 KPT+TSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS Sbjct: 117 KPTVTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 154 [129][TOP] >UniRef100_A8IR79 Histone H2B n=1 Tax=Chlamydomonas reinhardtii RepID=A8IR79_CHLRE Length = 153 Score = 75.1 bits (183), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 247 KPT+TSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS Sbjct: 115 KPTVTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 152 [130][TOP] >UniRef100_A8IJS4 Histone H2B n=1 Tax=Chlamydomonas reinhardtii RepID=A8IJS4_CHLRE Length = 153 Score = 75.1 bits (183), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 247 KPT+TSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS Sbjct: 115 KPTVTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 152 [131][TOP] >UniRef100_A8IJR6 Histone H2B n=1 Tax=Chlamydomonas reinhardtii RepID=A8IJR6_CHLRE Length = 152 Score = 75.1 bits (183), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 247 KPT+TSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS Sbjct: 114 KPTVTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 151 [132][TOP] >UniRef100_A8HWX5 Histone H2B n=1 Tax=Chlamydomonas reinhardtii RepID=A8HWX5_CHLRE Length = 153 Score = 75.1 bits (183), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 247 KPT+TSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS Sbjct: 115 KPTVTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 152 [133][TOP] >UniRef100_A8HWX1 Histone H2B n=2 Tax=Chlamydomonas reinhardtii RepID=A8HWX1_CHLRE Length = 153 Score = 75.1 bits (183), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 247 KPT+TSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS Sbjct: 115 KPTVTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 152 [134][TOP] >UniRef100_A8HWE3 Histone H2B n=1 Tax=Chlamydomonas reinhardtii RepID=A8HWE3_CHLRE Length = 153 Score = 75.1 bits (183), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 247 KPT+TSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS Sbjct: 115 KPTVTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 152 [135][TOP] >UniRef100_A8HSB2 Histone H2B n=1 Tax=Chlamydomonas reinhardtii RepID=A8HSB2_CHLRE Length = 156 Score = 75.1 bits (183), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 247 KPT+TSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS Sbjct: 118 KPTVTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 155 [136][TOP] >UniRef100_A4S1C9 Histone H2B n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4S1C9_OSTLU Length = 112 Score = 75.1 bits (183), Expect = 2e-12 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPT+TSREIQTAVRL+LPGELAKHAVSEGTKAVTKFTS+ Sbjct: 74 KPTVTSREIQTAVRLILPGELAKHAVSEGTKAVTKFTSA 112 [137][TOP] >UniRef100_P54347 Histone H2B.4 n=2 Tax=Chlamydomonas reinhardtii RepID=H2B4_CHLRE Length = 153 Score = 75.1 bits (183), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 247 KPT+TSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS Sbjct: 115 KPTVTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 152 [138][TOP] >UniRef100_P54346 Histone H2B.3 n=2 Tax=Chlamydomonas reinhardtii RepID=H2B3_CHLRE Length = 153 Score = 75.1 bits (183), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 247 KPT+TSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS Sbjct: 115 KPTVTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 152 [139][TOP] >UniRef100_P54345 Histone H2B.2 n=1 Tax=Chlamydomonas reinhardtii RepID=H2B2_CHLRE Length = 156 Score = 75.1 bits (183), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 247 KPT+TSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS Sbjct: 118 KPTVTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 155 [140][TOP] >UniRef100_P50565 Histone H2B.1 n=1 Tax=Chlamydomonas reinhardtii RepID=H2B1_CHLRE Length = 153 Score = 75.1 bits (183), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 247 KPT+TSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS Sbjct: 115 KPTVTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 152 [141][TOP] >UniRef100_UPI0000DD897B Os01g0152300 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000DD897B Length = 177 Score = 74.7 bits (182), Expect = 3e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTS+ Sbjct: 139 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSA 177 [142][TOP] >UniRef100_Q6E499 Histone H2B (Fragment) n=1 Tax=Cynodon dactylon RepID=Q6E499_CYNDA Length = 98 Score = 74.7 bits (182), Expect = 3e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTS+ Sbjct: 60 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSN 98 [143][TOP] >UniRef100_C5YZA2 Histone H2B n=1 Tax=Sorghum bicolor RepID=C5YZA2_SORBI Length = 147 Score = 74.7 bits (182), Expect = 3e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTS+ Sbjct: 109 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSA 147 [144][TOP] >UniRef100_C5WPC5 Histone H2B n=1 Tax=Sorghum bicolor RepID=C5WPC5_SORBI Length = 148 Score = 74.7 bits (182), Expect = 3e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTS+ Sbjct: 110 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSN 148 [145][TOP] >UniRef100_B6TWN0 Histone H2B n=1 Tax=Zea mays RepID=B6TWN0_MAIZE Length = 148 Score = 74.7 bits (182), Expect = 3e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTS+ Sbjct: 110 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSN 148 [146][TOP] >UniRef100_B6T9A0 Histone H2B n=1 Tax=Zea mays RepID=B6T9A0_MAIZE Length = 148 Score = 74.7 bits (182), Expect = 3e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTS+ Sbjct: 110 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSN 148 [147][TOP] >UniRef100_B6SIF9 Histone H2B n=1 Tax=Zea mays RepID=B6SIF9_MAIZE Length = 150 Score = 74.7 bits (182), Expect = 3e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTS+ Sbjct: 112 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSA 150 [148][TOP] >UniRef100_B6SHU4 Histone H2B n=1 Tax=Zea mays RepID=B6SHU4_MAIZE Length = 150 Score = 74.7 bits (182), Expect = 3e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTS+ Sbjct: 112 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSA 150 [149][TOP] >UniRef100_B4FYZ0 Histone H2B n=1 Tax=Zea mays RepID=B4FYZ0_MAIZE Length = 148 Score = 74.7 bits (182), Expect = 3e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTS+ Sbjct: 110 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSN 148 [150][TOP] >UniRef100_Q6F362 Histone H2B.9 n=3 Tax=Oryza sativa RepID=H2B9_ORYSJ Length = 152 Score = 74.7 bits (182), Expect = 3e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTS+ Sbjct: 114 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSA 152 [151][TOP] >UniRef100_Q7GBK0 Histone H2B.7 n=2 Tax=Oryza sativa RepID=H2B7_ORYSJ Length = 153 Score = 74.7 bits (182), Expect = 3e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTS+ Sbjct: 115 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSA 153 [152][TOP] >UniRef100_Q94JE1 Histone H2B.5 n=2 Tax=Oryza sativa RepID=H2B5_ORYSJ Length = 155 Score = 74.7 bits (182), Expect = 3e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTS+ Sbjct: 117 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSA 155 [153][TOP] >UniRef100_Q43215 Histone H2B.4 n=1 Tax=Triticum aestivum RepID=H2B4_WHEAT Length = 135 Score = 74.7 bits (182), Expect = 3e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTS+ Sbjct: 97 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSA 135 [154][TOP] >UniRef100_Q94JJ4 Histone H2B.4 n=3 Tax=Oryza sativa RepID=H2B4_ORYSJ Length = 153 Score = 74.7 bits (182), Expect = 3e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTS+ Sbjct: 115 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSA 153 [155][TOP] >UniRef100_Q43217 Histone H2B.3 n=1 Tax=Triticum aestivum RepID=H2B3_WHEAT Length = 138 Score = 74.7 bits (182), Expect = 3e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTS+ Sbjct: 100 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSA 138 [156][TOP] >UniRef100_Q94JJ7 Histone H2B.3 n=2 Tax=Oryza sativa Japonica Group RepID=H2B3_ORYSJ Length = 153 Score = 74.7 bits (182), Expect = 3e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTS+ Sbjct: 115 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSA 153 [157][TOP] >UniRef100_A2WKP3 Histone H2B.3 n=1 Tax=Oryza sativa Indica Group RepID=H2B3_ORYSI Length = 153 Score = 74.7 bits (182), Expect = 3e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTS+ Sbjct: 115 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSA 153 [158][TOP] >UniRef100_Q1SWQ1 Probable histone H2B.2 n=1 Tax=Medicago truncatula RepID=H2B2_MEDTR Length = 148 Score = 74.7 bits (182), Expect = 3e-12 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRLVLPGELAKH VSEGTKAVTKFTSS Sbjct: 110 KPTITSREIQTAVRLVLPGELAKHDVSEGTKAVTKFTSS 148 [159][TOP] >UniRef100_A3AGM4 Histone H2B.1 n=2 Tax=Oryza sativa RepID=H2B1_ORYSJ Length = 152 Score = 74.7 bits (182), Expect = 3e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTS+ Sbjct: 114 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSN 152 [160][TOP] >UniRef100_Q9LGI2 Histone H2B.10 n=1 Tax=Oryza sativa Japonica Group RepID=H2B10_ORYSJ Length = 153 Score = 74.7 bits (182), Expect = 3e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTS+ Sbjct: 115 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSA 153 [161][TOP] >UniRef100_A2WKS3 Histone H2B.10 n=1 Tax=Oryza sativa Indica Group RepID=H2B10_ORYSI Length = 153 Score = 74.7 bits (182), Expect = 3e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTS+ Sbjct: 115 KPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSA 153 [162][TOP] >UniRef100_Q84L43 Putative histone H4 n=1 Tax=Pinus pinaster RepID=Q84L43_PINPS Length = 141 Score = 74.3 bits (181), Expect = 4e-12 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRL LPGELAKHAVSEGTKAVTKFTS+ Sbjct: 103 KPTITSREIQTAVRLALPGELAKHAVSEGTKAVTKFTSA 141 [163][TOP] >UniRef100_B8LQJ5 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=B8LQJ5_PICSI Length = 141 Score = 74.3 bits (181), Expect = 4e-12 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRL LPGELAKHAVSEGTKAVTKFTS+ Sbjct: 103 KPTITSREIQTAVRLALPGELAKHAVSEGTKAVTKFTSA 141 [164][TOP] >UniRef100_B6UFX4 Histone H2B n=1 Tax=Zea mays RepID=B6UFX4_MAIZE Length = 151 Score = 74.3 bits (181), Expect = 4e-12 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVSEGTK VTKFTSS Sbjct: 113 KPTITSREIQTSVRLVLPGELAKHAVSEGTKVVTKFTSS 151 [165][TOP] >UniRef100_A9P0F9 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9P0F9_PICSI Length = 141 Score = 74.3 bits (181), Expect = 4e-12 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRL LPGELAKHAVSEGTKAVTKFTS+ Sbjct: 103 KPTITSREIQTAVRLALPGELAKHAVSEGTKAVTKFTSA 141 [166][TOP] >UniRef100_A9NXY8 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NXY8_PICSI Length = 141 Score = 74.3 bits (181), Expect = 4e-12 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRL LPGELAKHAVSEGTKAVTKFTS+ Sbjct: 103 KPTITSREIQTAVRLALPGELAKHAVSEGTKAVTKFTSA 141 [167][TOP] >UniRef100_A9NXC7 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NXC7_PICSI Length = 135 Score = 74.3 bits (181), Expect = 4e-12 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRL LPGELAKHAVSEGTKAVTKFTS+ Sbjct: 97 KPTITSREIQTAVRLALPGELAKHAVSEGTKAVTKFTSA 135 [168][TOP] >UniRef100_A9NU09 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NU09_PICSI Length = 142 Score = 74.3 bits (181), Expect = 4e-12 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRL LPGELAKHAVSEGTKAVTKFTS+ Sbjct: 104 KPTITSREIQTAVRLALPGELAKHAVSEGTKAVTKFTSA 142 [169][TOP] >UniRef100_A9NS95 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NS95_PICSI Length = 141 Score = 74.3 bits (181), Expect = 4e-12 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRL LPGELAKHAVSEGTKAVTKFTS+ Sbjct: 103 KPTITSREIQTAVRLALPGELAKHAVSEGTKAVTKFTSA 141 [170][TOP] >UniRef100_A9NRW4 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NRW4_PICSI Length = 141 Score = 74.3 bits (181), Expect = 4e-12 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRL LPGELAKHAVSEGTKAVTKFTS+ Sbjct: 103 KPTITSREIQTAVRLALPGELAKHAVSEGTKAVTKFTSA 141 [171][TOP] >UniRef100_A9NPQ4 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NPQ4_PICSI Length = 141 Score = 74.3 bits (181), Expect = 4e-12 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRL LPGELAKHAVSEGTKAVTKFTS+ Sbjct: 103 KPTITSREIQTAVRLALPGELAKHAVSEGTKAVTKFTSA 141 [172][TOP] >UniRef100_A9NP10 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NP10_PICSI Length = 141 Score = 74.3 bits (181), Expect = 4e-12 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRL LPGELAKHAVSEGTKAVTKFTS+ Sbjct: 103 KPTITSREIQTAVRLALPGELAKHAVSEGTKAVTKFTSA 141 [173][TOP] >UniRef100_A9NNW0 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NNW0_PICSI Length = 140 Score = 74.3 bits (181), Expect = 4e-12 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRL LPGELAKHAVSEGTKAVTKFTS+ Sbjct: 102 KPTITSREIQTAVRLALPGELAKHAVSEGTKAVTKFTSA 140 [174][TOP] >UniRef100_A9NNL3 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NNL3_PICSI Length = 141 Score = 74.3 bits (181), Expect = 4e-12 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRL LPGELAKHAVSEGTKAVTKFTS+ Sbjct: 103 KPTITSREIQTAVRLALPGELAKHAVSEGTKAVTKFTSA 141 [175][TOP] >UniRef100_A9NK34 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NK34_PICSI Length = 141 Score = 74.3 bits (181), Expect = 4e-12 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRL LPGELAKHAVSEGTKAVTKFTS+ Sbjct: 103 KPTITSREIQTAVRLALPGELAKHAVSEGTKAVTKFTSA 141 [176][TOP] >UniRef100_A9NJR4 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NJR4_PICSI Length = 135 Score = 74.3 bits (181), Expect = 4e-12 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQTAVRL LPGELAKHAVSEGTKAVTKFTS+ Sbjct: 97 KPTITSREIQTAVRLALPGELAKHAVSEGTKAVTKFTSA 135 [177][TOP] >UniRef100_Q5YJR5 Histone H2B (Fragment) n=1 Tax=Hyacinthus orientalis RepID=Q5YJR5_HYAOR Length = 175 Score = 73.6 bits (179), Expect = 7e-12 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQT+VRLVLPGELAKHAVS+GTKAVTKFTS+ Sbjct: 137 KPTITSREIQTSVRLVLPGELAKHAVSDGTKAVTKFTSA 175 [178][TOP] >UniRef100_B4DR52 Histone H2B n=1 Tax=Homo sapiens RepID=B4DR52_HUMAN Length = 166 Score = 72.4 bits (176), Expect = 1e-11 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS*TNNDNP 223 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS N +P Sbjct: 87 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSNPRNLSP 132 [179][TOP] >UniRef100_UPI00015DEAD1 histone cluster 1, H2be n=1 Tax=Mus musculus RepID=UPI00015DEAD1 Length = 134 Score = 72.0 bits (175), Expect = 2e-11 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS*TNN 232 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS ++N Sbjct: 87 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSNSSN 129 [180][TOP] >UniRef100_B4HDP3 Histone H2B n=1 Tax=Drosophila persimilis RepID=B4HDP3_DROPE Length = 204 Score = 71.6 bits (174), Expect = 3e-11 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 K TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 165 KSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 203 [181][TOP] >UniRef100_B5DNJ2 Histone H2B n=2 Tax=pseudoobscura subgroup RepID=B5DNJ2_DROPS Length = 127 Score = 71.6 bits (174), Expect = 3e-11 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 K TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 88 KSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 126 [182][TOP] >UniRef100_A7SHX4 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7SHX4_NEMVE Length = 222 Score = 71.6 bits (174), Expect = 3e-11 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 K TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 183 KSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 221 [183][TOP] >UniRef100_A7SGX3 Histone H2B (Fragment) n=1 Tax=Nematostella vectensis RepID=A7SGX3_NEMVE Length = 119 Score = 71.6 bits (174), Expect = 3e-11 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 K TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 80 KSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 118 [184][TOP] >UniRef100_A7S708 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7S708_NEMVE Length = 220 Score = 71.6 bits (174), Expect = 3e-11 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 K TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 181 KSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 219 [185][TOP] >UniRef100_A7S6Z7 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7S6Z7_NEMVE Length = 219 Score = 71.6 bits (174), Expect = 3e-11 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 K TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 180 KSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 218 [186][TOP] >UniRef100_A7S4X9 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7S4X9_NEMVE Length = 213 Score = 71.6 bits (174), Expect = 3e-11 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 K TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 174 KSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 212 [187][TOP] >UniRef100_A7RPY4 Histone H2B n=1 Tax=Nematostella vectensis RepID=A7RPY4_NEMVE Length = 123 Score = 71.6 bits (174), Expect = 3e-11 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 K TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 84 KSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 122 [188][TOP] >UniRef100_A7RPX4 Histone H2B n=1 Tax=Nematostella vectensis RepID=A7RPX4_NEMVE Length = 123 Score = 71.6 bits (174), Expect = 3e-11 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 K TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 84 KSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 122 [189][TOP] >UniRef100_A7RJP7 Histone H2B n=1 Tax=Nematostella vectensis RepID=A7RJP7_NEMVE Length = 123 Score = 71.6 bits (174), Expect = 3e-11 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 K TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 84 KSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 122 [190][TOP] >UniRef100_A7RJP4 Histone H2B n=1 Tax=Nematostella vectensis RepID=A7RJP4_NEMVE Length = 123 Score = 71.6 bits (174), Expect = 3e-11 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 K TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 84 KSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 122 [191][TOP] >UniRef100_A7RJN0 Histone H2B (Fragment) n=1 Tax=Nematostella vectensis RepID=A7RJN0_NEMVE Length = 115 Score = 71.6 bits (174), Expect = 3e-11 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 K TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 76 KSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 114 [192][TOP] >UniRef100_A7RJM8 Histone H2B n=2 Tax=Nematostella vectensis RepID=A7RJM8_NEMVE Length = 67 Score = 71.6 bits (174), Expect = 3e-11 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 K TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 28 KSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 66 [193][TOP] >UniRef100_A7RJL3 Histone H2B n=1 Tax=Nematostella vectensis RepID=A7RJL3_NEMVE Length = 123 Score = 71.6 bits (174), Expect = 3e-11 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 K TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 84 KSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 122 [194][TOP] >UniRef100_Q41575 Histone H2B.6 n=1 Tax=Triticum aestivum RepID=H2B6_WHEAT Length = 121 Score = 71.2 bits (173), Expect = 3e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFT 250 KPTITSREIQTAVRLV PGELAKHAVSEGTKAVT+FT Sbjct: 83 KPTITSREIQTAVRLVFPGELAKHAVSEGTKAVTRFT 119 [195][TOP] >UniRef100_UPI00015B553D PREDICTED: similar to Histone H2B n=1 Tax=Nasonia vitripennis RepID=UPI00015B553D Length = 130 Score = 70.9 bits (172), Expect = 4e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 K TITSREIQTAVRL+LPGE+AKHAVSEGTKAVTK+TSS Sbjct: 91 KSTITSREIQTAVRLLLPGEIAKHAVSEGTKAVTKYTSS 129 [196][TOP] >UniRef100_UPI0001A2DC96 UPI0001A2DC96 related cluster n=1 Tax=Danio rerio RepID=UPI0001A2DC96 Length = 133 Score = 70.9 bits (172), Expect = 4e-11 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS*T 238 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS T Sbjct: 85 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKT 125 [197][TOP] >UniRef100_Q8CBB6 Histone H2B n=2 Tax=Mus musculus RepID=Q8CBB6_MOUSE Length = 134 Score = 70.9 bits (172), Expect = 4e-11 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS*TNNDN 226 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS + N Sbjct: 87 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSNFSRQN 131 [198][TOP] >UniRef100_A9TL67 Histone H2B n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TL67_PHYPA Length = 133 Score = 70.9 bits (172), Expect = 4e-11 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 KPTITSREIQ AVRL+LPGELAKHAVSEGTKAVTK TS+ Sbjct: 95 KPTITSREIQIAVRLILPGELAKHAVSEGTKAVTKLTSA 133 [199][TOP] >UniRef100_UPI000186CBA7 histone H2B.3, putative n=1 Tax=Pediculus humanus corporis RepID=UPI000186CBA7 Length = 156 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 117 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 155 [200][TOP] >UniRef100_UPI000186C9F1 histone H2B.3, putative n=1 Tax=Pediculus humanus corporis RepID=UPI000186C9F1 Length = 123 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 84 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 122 [201][TOP] >UniRef100_UPI000185FB0C hypothetical protein BRAFLDRAFT_56905 n=1 Tax=Branchiostoma floridae RepID=UPI000185FB0C Length = 122 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 83 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 121 [202][TOP] >UniRef100_UPI00017F0810 PREDICTED: similar to histone H2B n=1 Tax=Sus scrofa RepID=UPI00017F0810 Length = 248 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 209 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 247 [203][TOP] >UniRef100_UPI00017F0783 PREDICTED: similar to histone cluster 1, H2ba n=1 Tax=Sus scrofa RepID=UPI00017F0783 Length = 127 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 88 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 126 [204][TOP] >UniRef100_UPI00017C2DB4 PREDICTED: similar to histone cluster 1, H2bd, partial n=1 Tax=Bos taurus RepID=UPI00017C2DB4 Length = 160 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 121 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 159 [205][TOP] >UniRef100_UPI0001797587 PREDICTED: similar to histone cluster 1, H2bd n=1 Tax=Equus caballus RepID=UPI0001797587 Length = 126 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 87 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 125 [206][TOP] >UniRef100_UPI000179293E PREDICTED: similar to Histone H2B n=1 Tax=Acyrthosiphon pisum RepID=UPI000179293E Length = 126 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 87 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 125 [207][TOP] >UniRef100_UPI00017916BA PREDICTED: similar to late histone H2B.L4 n=1 Tax=Acyrthosiphon pisum RepID=UPI00017916BA Length = 126 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 87 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 125 [208][TOP] >UniRef100_UPI0001791437 PREDICTED: similar to histone H2B-3 n=1 Tax=Acyrthosiphon pisum RepID=UPI0001791437 Length = 126 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 87 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 125 [209][TOP] >UniRef100_A6QQ28 Histone H2B n=5 Tax=Coelomata RepID=A6QQ28_BOVIN Length = 67 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 28 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 66 [210][TOP] >UniRef100_UPI00015B604D PREDICTED: similar to histone H2B n=1 Tax=Nasonia vitripennis RepID=UPI00015B604D Length = 300 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 261 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 299 [211][TOP] >UniRef100_UPI00015B54BC PREDICTED: similar to histone H2B n=1 Tax=Nasonia vitripennis RepID=UPI00015B54BC Length = 103 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 64 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 102 [212][TOP] >UniRef100_UPI00015B4E7C PREDICTED: similar to putative Rho1 n=1 Tax=Nasonia vitripennis RepID=UPI00015B4E7C Length = 277 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 238 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 276 [213][TOP] >UniRef100_UPI00015B4641 PREDICTED: similar to histone H2B, partial n=1 Tax=Nasonia vitripennis RepID=UPI00015B4641 Length = 276 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 237 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 275 [214][TOP] >UniRef100_UPI00015B42A8 PREDICTED: similar to histone H2B n=1 Tax=Nasonia vitripennis RepID=UPI00015B42A8 Length = 124 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 85 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 123 [215][TOP] >UniRef100_UPI00015B4250 PREDICTED: similar to histone H2B n=1 Tax=Nasonia vitripennis RepID=UPI00015B4250 Length = 124 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 85 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 123 [216][TOP] >UniRef100_UPI000155FF60 PREDICTED: similar to histone cluster 1, H2bb n=1 Tax=Equus caballus RepID=UPI000155FF60 Length = 126 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 87 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 125 [217][TOP] >UniRef100_UPI000155FD82 PREDICTED: similar to histone cluster 1, H2bd n=1 Tax=Equus caballus RepID=UPI000155FD82 Length = 126 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 87 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 125 [218][TOP] >UniRef100_UPI000155C35B PREDICTED: similar to histone H2B n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155C35B Length = 286 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 247 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 285 [219][TOP] >UniRef100_UPI000155C04A PREDICTED: similar to histone H2B n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155C04A Length = 266 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 227 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 265 [220][TOP] >UniRef100_UPI000155C044 PREDICTED: similar to histone H2B n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155C044 Length = 126 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 87 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 125 [221][TOP] >UniRef100_UPI000155C042 PREDICTED: similar to histone H2B n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155C042 Length = 126 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 87 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 125 [222][TOP] >UniRef100_UPI000155C016 PREDICTED: similar to histone H2B isoform 2 n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155C016 Length = 264 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 225 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 263 [223][TOP] >UniRef100_UPI000155C015 PREDICTED: similar to histone H2B isoform 1 n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155C015 Length = 296 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 257 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 295 [224][TOP] >UniRef100_UPI000155C011 PREDICTED: similar to histone H2B n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155C011 Length = 126 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 87 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 125 [225][TOP] >UniRef100_UPI0000F2C498 PREDICTED: similar to LReO_3 n=1 Tax=Monodelphis domestica RepID=UPI0000F2C498 Length = 126 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 87 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 125 [226][TOP] >UniRef100_UPI0000F2BE9D PREDICTED: similar to histone 1, H2bn, n=1 Tax=Monodelphis domestica RepID=UPI0000F2BE9D Length = 126 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 87 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 125 [227][TOP] >UniRef100_UPI0000F21656 PREDICTED: similar to histone cluster 2, H2be n=1 Tax=Danio rerio RepID=UPI0000F21656 Length = 124 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 85 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 123 [228][TOP] >UniRef100_UPI0000EDA60B PREDICTED: similar to histone H2B n=1 Tax=Ornithorhynchus anatinus RepID=UPI0000EDA60B Length = 126 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 87 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 125 [229][TOP] >UniRef100_UPI0000EBCD45 PREDICTED: similar to histone cluster 1, H2bd n=1 Tax=Bos taurus RepID=UPI0000EBCD45 Length = 126 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 87 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 125 [230][TOP] >UniRef100_UPI0000E2EDEC PREDICTED: similar to histone 1, H2bn (predicted) n=1 Tax=Equus caballus RepID=UPI0000E2EDEC Length = 126 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 87 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 125 [231][TOP] >UniRef100_UPI0000E20E07 PREDICTED: similar to histone H2B n=1 Tax=Pan troglodytes RepID=UPI0000E20E07 Length = 152 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 113 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 151 [232][TOP] >UniRef100_UPI0000E20DF2 PREDICTED: similar to histone H2b-616 n=1 Tax=Pan troglodytes RepID=UPI0000E20DF2 Length = 148 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 109 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 147 [233][TOP] >UniRef100_UPI0000E20DF1 PREDICTED: hypothetical protein n=1 Tax=Pan troglodytes RepID=UPI0000E20DF1 Length = 150 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 111 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 149 [234][TOP] >UniRef100_UPI0000DB6C2B PREDICTED: similar to Histone H2B n=1 Tax=Apis mellifera RepID=UPI0000DB6C2B Length = 123 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 84 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 122 [235][TOP] >UniRef100_UPI0000D9AB93 PREDICTED: similar to H2B histone family, member F n=1 Tax=Macaca mulatta RepID=UPI0000D9AB93 Length = 154 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 115 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 153 [236][TOP] >UniRef100_UPI0000D99B9B PREDICTED: similar to Histone H2B 291B n=1 Tax=Macaca mulatta RepID=UPI0000D99B9B Length = 191 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 152 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 190 [237][TOP] >UniRef100_UPI0000D91EDB PREDICTED: similar to histone H2B n=1 Tax=Monodelphis domestica RepID=UPI0000D91EDB Length = 126 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 87 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 125 [238][TOP] >UniRef100_UPI0000D57942 PREDICTED: similar to Histone H2B n=1 Tax=Tribolium castaneum RepID=UPI0000D57942 Length = 165 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 126 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 164 [239][TOP] >UniRef100_UPI0000D578A5 PREDICTED: similar to Histone H2B n=1 Tax=Tribolium castaneum RepID=UPI0000D578A5 Length = 621 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 582 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 620 [240][TOP] >UniRef100_UPI00006D237A PREDICTED: similar to H2B histone family, member E n=1 Tax=Macaca mulatta RepID=UPI00006D237A Length = 126 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 87 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 125 [241][TOP] >UniRef100_A0JLV3 Histone H2B (Fragment) n=2 Tax=Euarchontoglires RepID=A0JLV3_MOUSE Length = 123 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 84 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 122 [242][TOP] >UniRef100_UPI00006154CA PREDICTED: similar to histone cluster 1, H2bc n=1 Tax=Bos taurus RepID=UPI00006154CA Length = 126 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 87 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 125 [243][TOP] >UniRef100_UPI00005A57D9 PREDICTED: similar to histone 1, H2bh isoform 1 n=1 Tax=Canis lupus familiaris RepID=UPI00005A57D9 Length = 113 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 74 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 112 [244][TOP] >UniRef100_UPI00005A57CD PREDICTED: similar to histone 1, H2ai (predicted) isoform 1 n=1 Tax=Canis lupus familiaris RepID=UPI00005A57CD Length = 259 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 220 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 258 [245][TOP] >UniRef100_UPI000057D1D2 PREDICTED: similar to histone H2B n=1 Tax=Bos taurus RepID=UPI000057D1D2 Length = 127 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 88 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 126 [246][TOP] >UniRef100_UPI00004F0F3F PREDICTED: similar to Hist1h2bj protein n=1 Tax=Bos taurus RepID=UPI00004F0F3F Length = 126 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 87 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 125 [247][TOP] >UniRef100_UPI00004EF351 PREDICTED: similar to histone H2B n=1 Tax=Bos taurus RepID=UPI00004EF351 Length = 127 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 88 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 126 [248][TOP] >UniRef100_UPI00003C0EF7 PREDICTED: similar to Histone H2B n=1 Tax=Apis mellifera RepID=UPI00003C0EF7 Length = 123 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 84 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 122 [249][TOP] >UniRef100_UPI00003C0C38 PREDICTED: similar to Histone H2B n=1 Tax=Apis mellifera RepID=UPI00003C0C38 Length = 123 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 84 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 122 [250][TOP] >UniRef100_UPI000036D5A6 PREDICTED: hypothetical protein isoform 2 n=1 Tax=Pan troglodytes RepID=UPI000036D5A6 Length = 126 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -2 Query: 360 KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 244 + TITSREIQTAVRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 87 RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 125