[UP]
[1][TOP]
>UniRef100_UPI0001982D86 PREDICTED: similar to UBX domain-containing protein n=1 Tax=Vitis
vinifera RepID=UPI0001982D86
Length = 470
Score = 54.7 bits (130), Expect(2) = 1e-13
Identities = 26/28 (92%), Positives = 27/28 (96%)
Frame = -3
Query: 121 PRVVYGQEKLTLSLKEAGLHPQASLFVE 38
PRVVYG EKL+LSLKEAGLHPQASLFVE
Sbjct: 441 PRVVYGPEKLSLSLKEAGLHPQASLFVE 468
Score = 44.7 bits (104), Expect(2) = 1e-13
Identities = 19/21 (90%), Positives = 21/21 (100%)
Frame = -2
Query: 185 YDYVDSLGCLEADSYSLVSNF 123
YDYVDSLGCL+A+SYSLVSNF
Sbjct: 420 YDYVDSLGCLDAESYSLVSNF 440
[2][TOP]
>UniRef100_A7QJ84 Chromosome chr2 scaffold_105, whole genome shotgun sequence n=1
Tax=Vitis vinifera RepID=A7QJ84_VITVI
Length = 202
Score = 54.7 bits (130), Expect(2) = 2e-13
Identities = 26/28 (92%), Positives = 27/28 (96%)
Frame = -3
Query: 121 PRVVYGQEKLTLSLKEAGLHPQASLFVE 38
PRVVYG EKL+LSLKEAGLHPQASLFVE
Sbjct: 173 PRVVYGPEKLSLSLKEAGLHPQASLFVE 200
Score = 44.7 bits (104), Expect(2) = 2e-13
Identities = 19/21 (90%), Positives = 21/21 (100%)
Frame = -2
Query: 185 YDYVDSLGCLEADSYSLVSNF 123
YDYVDSLGCL+A+SYSLVSNF
Sbjct: 152 YDYVDSLGCLDAESYSLVSNF 172
[3][TOP]
>UniRef100_B9RYS0 UBX domain-containing protein, putative n=1 Tax=Ricinus communis
RepID=B9RYS0_RICCO
Length = 471
Score = 54.3 bits (129), Expect(2) = 9e-13
Identities = 26/30 (86%), Positives = 27/30 (90%)
Frame = -3
Query: 121 PRVVYGQEKLTLSLKEAGLHPQASLFVELS 32
PR VYG EKL LSLKEAGLHPQASLFVEL+
Sbjct: 442 PRTVYGTEKLCLSLKEAGLHPQASLFVELN 471
Score = 42.4 bits (98), Expect(2) = 9e-13
Identities = 19/21 (90%), Positives = 20/21 (95%)
Frame = -2
Query: 185 YDYVDSLGCLEADSYSLVSNF 123
YDYVDSLG LEAD+YSLVSNF
Sbjct: 421 YDYVDSLGLLEADTYSLVSNF 441
[4][TOP]
>UniRef100_B9GXV5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GXV5_POPTR
Length = 474
Score = 54.3 bits (129), Expect(2) = 1e-12
Identities = 25/30 (83%), Positives = 29/30 (96%)
Frame = -3
Query: 121 PRVVYGQEKLTLSLKEAGLHPQASLFVELS 32
PRVVYG +K++LSLKEAGLHPQASLFVEL+
Sbjct: 445 PRVVYGTDKVSLSLKEAGLHPQASLFVELN 474
Score = 42.0 bits (97), Expect(2) = 1e-12
Identities = 17/21 (80%), Positives = 20/21 (95%)
Frame = -2
Query: 185 YDYVDSLGCLEADSYSLVSNF 123
YDYVDSLGCL+ ++YSLVSNF
Sbjct: 424 YDYVDSLGCLDVENYSLVSNF 444
[5][TOP]
>UniRef100_Q5DJU1 Fas-associated factor 1-like protein n=1 Tax=Capsicum annuum
RepID=Q5DJU1_CAPAN
Length = 468
Score = 52.4 bits (124), Expect(2) = 3e-12
Identities = 24/30 (80%), Positives = 26/30 (86%)
Frame = -3
Query: 121 PRVVYGQEKLTLSLKEAGLHPQASLFVELS 32
PR VYG EKL LSLK+ GLHPQASLFVEL+
Sbjct: 438 PRTVYGSEKLALSLKDTGLHPQASLFVELN 467
Score = 42.7 bits (99), Expect(2) = 3e-12
Identities = 18/21 (85%), Positives = 19/21 (90%)
Frame = -2
Query: 185 YDYVDSLGCLEADSYSLVSNF 123
YDYVDSLGCLE + YSLVSNF
Sbjct: 417 YDYVDSLGCLEVEKYSLVSNF 437
[6][TOP]
>UniRef100_B9GK93 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GK93_POPTR
Length = 473
Score = 54.3 bits (129), Expect(2) = 3e-11
Identities = 25/30 (83%), Positives = 29/30 (96%)
Frame = -3
Query: 121 PRVVYGQEKLTLSLKEAGLHPQASLFVELS 32
PRVVYG +K++LSLKEAGLHPQASLFVEL+
Sbjct: 444 PRVVYGTDKVSLSLKEAGLHPQASLFVELN 473
Score = 37.4 bits (85), Expect(2) = 3e-11
Identities = 16/21 (76%), Positives = 18/21 (85%)
Frame = -2
Query: 185 YDYVDSLGCLEADSYSLVSNF 123
YDYVDSLG L ++YSLVSNF
Sbjct: 423 YDYVDSLGSLNVENYSLVSNF 443
[7][TOP]
>UniRef100_Q9FWC4 cDNA clone:J023077I21, full insert sequence n=1 Tax=Oryza sativa
Japonica Group RepID=Q9FWC4_ORYSJ
Length = 466
Score = 48.5 bits (114), Expect(2) = 2e-10
Identities = 21/29 (72%), Positives = 26/29 (89%)
Frame = -3
Query: 121 PRVVYGQEKLTLSLKEAGLHPQASLFVEL 35
PRV YG EKL+ +L+EAGLHPQASLF+E+
Sbjct: 436 PRVTYGPEKLSQTLEEAGLHPQASLFIEI 464
Score = 40.0 bits (92), Expect(2) = 2e-10
Identities = 17/21 (80%), Positives = 19/21 (90%)
Frame = -2
Query: 185 YDYVDSLGCLEADSYSLVSNF 123
YDYVDSL CL+A+ YSLVSNF
Sbjct: 415 YDYVDSLDCLKAEKYSLVSNF 435
[8][TOP]
>UniRef100_A2Z9E8 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
RepID=A2Z9E8_ORYSI
Length = 465
Score = 48.5 bits (114), Expect(2) = 2e-10
Identities = 21/29 (72%), Positives = 26/29 (89%)
Frame = -3
Query: 121 PRVVYGQEKLTLSLKEAGLHPQASLFVEL 35
PRV YG EKL+ +L+EAGLHPQASLF+E+
Sbjct: 435 PRVTYGPEKLSQTLEEAGLHPQASLFIEI 463
Score = 40.0 bits (92), Expect(2) = 2e-10
Identities = 17/21 (80%), Positives = 19/21 (90%)
Frame = -2
Query: 185 YDYVDSLGCLEADSYSLVSNF 123
YDYVDSL CL+A+ YSLVSNF
Sbjct: 414 YDYVDSLDCLKAEKYSLVSNF 434
[9][TOP]
>UniRef100_A3C6J4 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
Group RepID=A3C6J4_ORYSJ
Length = 436
Score = 48.5 bits (114), Expect(2) = 2e-10
Identities = 21/29 (72%), Positives = 26/29 (89%)
Frame = -3
Query: 121 PRVVYGQEKLTLSLKEAGLHPQASLFVEL 35
PRV YG EKL+ +L+EAGLHPQASLF+E+
Sbjct: 406 PRVTYGPEKLSQTLEEAGLHPQASLFIEI 434
Score = 40.0 bits (92), Expect(2) = 2e-10
Identities = 17/21 (80%), Positives = 19/21 (90%)
Frame = -2
Query: 185 YDYVDSLGCLEADSYSLVSNF 123
YDYVDSL CL+A+ YSLVSNF
Sbjct: 385 YDYVDSLDCLKAEKYSLVSNF 405
[10][TOP]
>UniRef100_Q0IWB6 Os10g0520600 protein (Fragment) n=1 Tax=Oryza sativa Japonica Group
RepID=Q0IWB6_ORYSJ
Length = 369
Score = 48.5 bits (114), Expect(2) = 2e-10
Identities = 21/29 (72%), Positives = 26/29 (89%)
Frame = -3
Query: 121 PRVVYGQEKLTLSLKEAGLHPQASLFVEL 35
PRV YG EKL+ +L+EAGLHPQASLF+E+
Sbjct: 339 PRVTYGPEKLSQTLEEAGLHPQASLFIEI 367
Score = 40.0 bits (92), Expect(2) = 2e-10
Identities = 17/21 (80%), Positives = 19/21 (90%)
Frame = -2
Query: 185 YDYVDSLGCLEADSYSLVSNF 123
YDYVDSL CL+A+ YSLVSNF
Sbjct: 318 YDYVDSLDCLKAEKYSLVSNF 338
[11][TOP]
>UniRef100_A2Z9E5 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
RepID=A2Z9E5_ORYSI
Length = 81
Score = 45.8 bits (107), Expect(2) = 1e-09
Identities = 20/29 (68%), Positives = 25/29 (86%)
Frame = -3
Query: 121 PRVVYGQEKLTLSLKEAGLHPQASLFVEL 35
PRV YG EK + +L+EAGLHPQASLF+E+
Sbjct: 51 PRVTYGPEKHSQTLEEAGLHPQASLFIEI 79
Score = 40.0 bits (92), Expect(2) = 1e-09
Identities = 17/21 (80%), Positives = 19/21 (90%)
Frame = -2
Query: 185 YDYVDSLGCLEADSYSLVSNF 123
YDYVDSL CL+A+ YSLVSNF
Sbjct: 30 YDYVDSLDCLKAEKYSLVSNF 50
[12][TOP]
>UniRef100_Q9M0N1 Putative uncharacterized protein AT4g10790 n=1 Tax=Arabidopsis
thaliana RepID=Q9M0N1_ARATH
Length = 480
Score = 48.9 bits (115), Expect(2) = 2e-09
Identities = 20/30 (66%), Positives = 28/30 (93%)
Frame = -3
Query: 121 PRVVYGQEKLTLSLKEAGLHPQASLFVELS 32
PR VYG++K ++SLK+AGLHPQASLF+E++
Sbjct: 451 PRTVYGRDKESMSLKDAGLHPQASLFIEIN 480
Score = 36.2 bits (82), Expect(2) = 2e-09
Identities = 14/21 (66%), Positives = 18/21 (85%)
Frame = -2
Query: 185 YDYVDSLGCLEADSYSLVSNF 123
YDYVDSLG L+ + YSL++NF
Sbjct: 430 YDYVDSLGLLDTEEYSLITNF 450
[13][TOP]
>UniRef100_O82483 T12H20.9 protein n=1 Tax=Arabidopsis thaliana RepID=O82483_ARATH
Length = 466
Score = 48.9 bits (115), Expect(2) = 2e-09
Identities = 20/30 (66%), Positives = 28/30 (93%)
Frame = -3
Query: 121 PRVVYGQEKLTLSLKEAGLHPQASLFVELS 32
PR VYG++K ++SLK+AGLHPQASLF+E++
Sbjct: 437 PRTVYGRDKESMSLKDAGLHPQASLFIEIN 466
Score = 36.2 bits (82), Expect(2) = 2e-09
Identities = 14/21 (66%), Positives = 18/21 (85%)
Frame = -2
Query: 185 YDYVDSLGCLEADSYSLVSNF 123
YDYVDSLG L+ + YSL++NF
Sbjct: 416 YDYVDSLGLLDTEEYSLITNF 436
[14][TOP]
>UniRef100_Q67XY6 Putative uncharacterized protein At4g10790 (Fragment) n=1
Tax=Arabidopsis thaliana RepID=Q67XY6_ARATH
Length = 296
Score = 48.9 bits (115), Expect(2) = 2e-09
Identities = 20/30 (66%), Positives = 28/30 (93%)
Frame = -3
Query: 121 PRVVYGQEKLTLSLKEAGLHPQASLFVELS 32
PR VYG++K ++SLK+AGLHPQASLF+E++
Sbjct: 267 PRTVYGRDKESMSLKDAGLHPQASLFIEIN 296
Score = 36.2 bits (82), Expect(2) = 2e-09
Identities = 14/21 (66%), Positives = 18/21 (85%)
Frame = -2
Query: 185 YDYVDSLGCLEADSYSLVSNF 123
YDYVDSLG L+ + YSL++NF
Sbjct: 246 YDYVDSLGLLDTEEYSLITNF 266
[15][TOP]
>UniRef100_A9TYB0 Predicted protein (Fragment) n=1 Tax=Physcomitrella patens subsp.
patens RepID=A9TYB0_PHYPA
Length = 462
Score = 42.7 bits (99), Expect(2) = 1e-07
Identities = 20/27 (74%), Positives = 22/27 (81%)
Frame = -3
Query: 121 PRVVYGQEKLTLSLKEAGLHPQASLFV 41
PRVVYG EK +LK+AGLHP ASLFV
Sbjct: 436 PRVVYGPEKRGQTLKDAGLHPHASLFV 462
Score = 36.2 bits (82), Expect(2) = 1e-07
Identities = 16/21 (76%), Positives = 18/21 (85%)
Frame = -2
Query: 185 YDYVDSLGCLEADSYSLVSNF 123
YDYVDSLG LEA Y+LV+NF
Sbjct: 415 YDYVDSLGTLEAVKYNLVTNF 435
[16][TOP]
>UniRef100_A9U4R0 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens
RepID=A9U4R0_PHYPA
Length = 466
Score = 46.6 bits (109), Expect(2) = 4e-07
Identities = 22/27 (81%), Positives = 23/27 (85%)
Frame = -3
Query: 121 PRVVYGQEKLTLSLKEAGLHPQASLFV 41
PRVVYG EK L+LKEAGLHP ASLFV
Sbjct: 435 PRVVYGPEKRCLTLKEAGLHPHASLFV 461
Score = 30.8 bits (68), Expect(2) = 4e-07
Identities = 13/21 (61%), Positives = 15/21 (71%)
Frame = -2
Query: 185 YDYVDSLGCLEADSYSLVSNF 123
YDY+DSLG L Y LV+NF
Sbjct: 414 YDYIDSLGTLGIIKYDLVTNF 434