[UP]
[1][TOP] >UniRef100_UPI00005DC295 NRPC2; DNA binding / DNA-directed RNA polymerase/ ribonucleoside binding n=1 Tax=Arabidopsis thaliana RepID=UPI00005DC295 Length = 1161 Score = 51.6 bits (122), Expect(2) = 2e-13 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = -3 Query: 309 MKLPYACKLLIQELQSMNIVPRLKLAD 229 MKLPYACKLL QELQSMN+VPRLKL + Sbjct: 1134 MKLPYACKLLFQELQSMNVVPRLKLTE 1160 Score = 47.0 bits (110), Expect(2) = 2e-13 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = -1 Query: 413 QVQVCRSCGLLGYYNYKLKIGVC 345 +VQVCR+CGLLGYYNYKLK VC Sbjct: 1100 EVQVCRACGLLGYYNYKLKKAVC 1122 [2][TOP] >UniRef100_B9IDF9 DNA-directed RNA polymerase (Fragment) n=1 Tax=Populus trichocarpa RepID=B9IDF9_POPTR Length = 1141 Score = 55.5 bits (132), Expect(2) = 5e-13 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -3 Query: 339 TLRMETRFPNMKLPYACKLLIQELQSMNIVPRLKLAD 229 T + + MKLPYACKLLIQELQSMNIVPRLKLA+ Sbjct: 1104 TCKNGDKVSTMKLPYACKLLIQELQSMNIVPRLKLAE 1140 Score = 42.0 bits (97), Expect(2) = 5e-13 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = -1 Query: 413 QVQVCRSCGLLGYYNYKLKIGVC 345 + QVCR+CGLLGYYN KLK +C Sbjct: 1080 EAQVCRACGLLGYYNQKLKAAMC 1102 [3][TOP] >UniRef100_A9RNX6 DNA-directed RNA polymerase n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RNX6_PHYPA Length = 1135 Score = 55.5 bits (132), Expect(2) = 2e-12 Identities = 27/41 (65%), Positives = 29/41 (70%) Frame = -3 Query: 351 CLSITLRMETRFPNMKLPYACKLLIQELQSMNIVPRLKLAD 229 CL T + MKLPYACKLL QELQSMNIVPRL LA+ Sbjct: 1094 CLCSTCKSGDNIATMKLPYACKLLFQELQSMNIVPRLTLAE 1134 Score = 40.0 bits (92), Expect(2) = 2e-12 Identities = 14/23 (60%), Positives = 20/23 (86%) Frame = -1 Query: 413 QVQVCRSCGLLGYYNYKLKIGVC 345 Q+QVC CG++GYY++KLKI +C Sbjct: 1074 QIQVCTKCGMIGYYHHKLKICLC 1096 [4][TOP] >UniRef100_Q84R88 DNA-directed RNA polymerase n=1 Tax=Oryza sativa Japonica Group RepID=Q84R88_ORYSJ Length = 1174 Score = 48.5 bits (114), Expect(2) = 9e-12 Identities = 20/27 (74%), Positives = 25/27 (92%) Frame = -3 Query: 309 MKLPYACKLLIQELQSMNIVPRLKLAD 229 M++PYACKLL QELQ+MN+VPRLKL + Sbjct: 1147 MRMPYACKLLFQELQAMNVVPRLKLTE 1173 Score = 44.7 bits (104), Expect(2) = 9e-12 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -1 Query: 413 QVQVCRSCGLLGYYNYKLKIGVC 345 QVQVCR CGLLGYYN+KLK C Sbjct: 1113 QVQVCRKCGLLGYYNHKLKASYC 1135 [5][TOP] >UniRef100_Q10JZ3 DNA-directed RNA polymerase n=1 Tax=Oryza sativa Japonica Group RepID=Q10JZ3_ORYSJ Length = 1155 Score = 48.5 bits (114), Expect(2) = 9e-12 Identities = 20/27 (74%), Positives = 25/27 (92%) Frame = -3 Query: 309 MKLPYACKLLIQELQSMNIVPRLKLAD 229 M++PYACKLL QELQ+MN+VPRLKL + Sbjct: 1128 MRMPYACKLLFQELQAMNVVPRLKLTE 1154 Score = 44.7 bits (104), Expect(2) = 9e-12 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -1 Query: 413 QVQVCRSCGLLGYYNYKLKIGVC 345 QVQVCR CGLLGYYN+KLK C Sbjct: 1094 QVQVCRKCGLLGYYNHKLKASYC 1116 [6][TOP] >UniRef100_B8AR02 DNA-directed RNA polymerase n=1 Tax=Oryza sativa Indica Group RepID=B8AR02_ORYSI Length = 1117 Score = 48.5 bits (114), Expect(2) = 9e-12 Identities = 20/27 (74%), Positives = 25/27 (92%) Frame = -3 Query: 309 MKLPYACKLLIQELQSMNIVPRLKLAD 229 M++PYACKLL QELQ+MN+VPRLKL + Sbjct: 1090 MRMPYACKLLFQELQAMNVVPRLKLTE 1116 Score = 44.7 bits (104), Expect(2) = 9e-12 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -1 Query: 413 QVQVCRSCGLLGYYNYKLKIGVC 345 QVQVCR CGLLGYYN+KLK C Sbjct: 1056 QVQVCRKCGLLGYYNHKLKASYC 1078 [7][TOP] >UniRef100_B9F8X6 DNA-directed RNA polymerase n=1 Tax=Oryza sativa Japonica Group RepID=B9F8X6_ORYSJ Length = 1115 Score = 48.5 bits (114), Expect(2) = 9e-12 Identities = 20/27 (74%), Positives = 25/27 (92%) Frame = -3 Query: 309 MKLPYACKLLIQELQSMNIVPRLKLAD 229 M++PYACKLL QELQ+MN+VPRLKL + Sbjct: 1088 MRMPYACKLLFQELQAMNVVPRLKLTE 1114 Score = 44.7 bits (104), Expect(2) = 9e-12 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -1 Query: 413 QVQVCRSCGLLGYYNYKLKIGVC 345 QVQVCR CGLLGYYN+KLK C Sbjct: 1054 QVQVCRKCGLLGYYNHKLKASYC 1076 [8][TOP] >UniRef100_C5Z6F6 DNA-directed RNA polymerase n=1 Tax=Sorghum bicolor RepID=C5Z6F6_SORBI Length = 1137 Score = 47.4 bits (111), Expect(2) = 2e-11 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = -3 Query: 309 MKLPYACKLLIQELQSMNIVPRLKLAD 229 M+LPYACKLL QEL +MN+VPRLKL + Sbjct: 1110 MRLPYACKLLFQELHAMNVVPRLKLTE 1136 Score = 44.7 bits (104), Expect(2) = 2e-11 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -1 Query: 413 QVQVCRSCGLLGYYNYKLKIGVC 345 QVQVCR CGLLGYYN+KLK C Sbjct: 1076 QVQVCRKCGLLGYYNHKLKTSYC 1098 [9][TOP] >UniRef100_Q9FKF1 DNA-directed RNA polymerase n=1 Tax=Arabidopsis thaliana RepID=Q9FKF1_ARATH Length = 1194 Score = 47.0 bits (110), Expect(2) = 1e-07 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = -1 Query: 413 QVQVCRSCGLLGYYNYKLKIGVC 345 +VQVCR+CGLLGYYNYKLK VC Sbjct: 1110 EVQVCRACGLLGYYNYKLKKAVC 1132 Score = 32.0 bits (71), Expect(2) = 1e-07 Identities = 17/39 (43%), Positives = 27/39 (69%) Frame = -3 Query: 309 MKLPYACKLLIQELQSMNIVPRLKLADP*DLSNELNLVI 193 MKLPYACKLL Q ++++ + +LKL+ L N+ ++I Sbjct: 1144 MKLPYACKLLFQ-VKTIGLFFKLKLSTSSHLENDKIILI 1181 [10][TOP] >UniRef100_C1FIF0 DNA-directed RNA polymerase n=1 Tax=Micromonas sp. RCC299 RepID=C1FIF0_9CHLO Length = 1159 Score = 48.5 bits (114), Expect(2) = 1e-06 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = -3 Query: 309 MKLPYACKLLIQELQSMNIVPRLKLAD 229 +KLPYACKLL QELQSMNI PRL L+D Sbjct: 1132 LKLPYACKLLFQELQSMNICPRLTLSD 1158 Score = 27.3 bits (59), Expect(2) = 1e-06 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -1 Query: 413 QVQVCRSCGLLGYYNYKLKIGVC 345 + QVC +CGLLGY ++ +C Sbjct: 1098 EAQVCTNCGLLGYKHHGTGRNLC 1120 [11][TOP] >UniRef100_A4RS40 DNA-directed RNA polymerase n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4RS40_OSTLU Length = 1146 Score = 48.9 bits (115), Expect(2) = 1e-06 Identities = 22/35 (62%), Positives = 25/35 (71%) Frame = -3 Query: 333 RMETRFPNMKLPYACKLLIQELQSMNIVPRLKLAD 229 + E +KLPYACKLL QELQSMNI PRL L + Sbjct: 1111 KTEAEVATLKLPYACKLLFQELQSMNIAPRLSLTE 1145 Score = 26.6 bits (57), Expect(2) = 1e-06 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -1 Query: 413 QVQVCRSCGLLGYYNYKLKIGVC 345 + QVC CGLLG+ ++ + C Sbjct: 1085 EAQVCTKCGLLGFQHHITRRNAC 1107 [12][TOP] >UniRef100_B9SHS2 DNA-directed RNA polymerase n=1 Tax=Ricinus communis RepID=B9SHS2_RICCO Length = 1139 Score = 55.5 bits (132), Expect = 2e-06 Identities = 34/70 (48%), Positives = 41/70 (58%) Frame = -3 Query: 438 LMLFSDPFASSGL*IVWVVRILQL*VENWCLSITLRMETRFPNMKLPYACKLLIQELQSM 259 LM+ SDPF + ++ + S T + MKLPYACKLLIQELQSM Sbjct: 1070 LMISSDPFEVQVCRVCGLLGYFNQKLRAGICS-TCKNGDNISTMKLPYACKLLIQELQSM 1128 Query: 258 NIVPRLKLAD 229 NIVPRLKLA+ Sbjct: 1129 NIVPRLKLAE 1138 [13][TOP] >UniRef100_UPI000194E18E PREDICTED: hypothetical protein n=1 Tax=Taeniopygia guttata RepID=UPI000194E18E Length = 1280 Score = 49.7 bits (117), Expect(2) = 2e-06 Identities = 21/27 (77%), Positives = 26/27 (96%) Frame = -3 Query: 312 NMKLPYACKLLIQELQSMNIVPRLKLA 232 ++++PYACKLL QELQSMNI+PRLKLA Sbjct: 1250 SLRIPYACKLLFQELQSMNIIPRLKLA 1276 Score = 25.0 bits (53), Expect(2) = 2e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 413 QVQVCRSCGLLGY 375 +V VC CGLLGY Sbjct: 1223 EVDVCGQCGLLGY 1235 [14][TOP] >UniRef100_UPI00004DA04E DNA-directed RNA polymerase III subunit RPC2 (EC 2.7.7.6) (RNA polymerase III subunit C2) (DNA-directed RNA polymerase III subunit B) (DNA-directed RNA polymerase III 127.6 kDa polypeptide) (C128). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI00004DA04E Length = 1136 Score = 49.7 bits (117), Expect(2) = 2e-06 Identities = 21/27 (77%), Positives = 26/27 (96%) Frame = -3 Query: 312 NMKLPYACKLLIQELQSMNIVPRLKLA 232 ++++PYACKLL QELQSMNI+PRLKLA Sbjct: 1106 SLRIPYACKLLFQELQSMNIIPRLKLA 1132 Score = 25.0 bits (53), Expect(2) = 2e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 413 QVQVCRSCGLLGY 375 +V VC CGLLGY Sbjct: 1079 EVDVCGKCGLLGY 1091 [15][TOP] >UniRef100_B2GUR3 DNA-directed RNA polymerase n=1 Tax=Xenopus (Silurana) tropicalis RepID=B2GUR3_XENTR Length = 1134 Score = 49.7 bits (117), Expect(2) = 2e-06 Identities = 21/27 (77%), Positives = 26/27 (96%) Frame = -3 Query: 312 NMKLPYACKLLIQELQSMNIVPRLKLA 232 ++++PYACKLL QELQSMNI+PRLKLA Sbjct: 1104 SLRIPYACKLLFQELQSMNIIPRLKLA 1130 Score = 25.0 bits (53), Expect(2) = 2e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 413 QVQVCRSCGLLGY 375 +V VC CGLLGY Sbjct: 1077 EVDVCGKCGLLGY 1089 [16][TOP] >UniRef100_UPI0000503D79 polymerase (RNA) III (DNA directed) polypeptide B n=2 Tax=Rattus norvegicus RepID=UPI0000503D79 Length = 1133 Score = 49.7 bits (117), Expect(2) = 2e-06 Identities = 21/27 (77%), Positives = 26/27 (96%) Frame = -3 Query: 312 NMKLPYACKLLIQELQSMNIVPRLKLA 232 ++++PYACKLL QELQSMNI+PRLKLA Sbjct: 1103 SLRIPYACKLLFQELQSMNIIPRLKLA 1129 Score = 25.0 bits (53), Expect(2) = 2e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 413 QVQVCRSCGLLGY 375 +V VC CGLLGY Sbjct: 1076 EVDVCGQCGLLGY 1088 [17][TOP] >UniRef100_P59470 DNA-directed RNA polymerase III subunit RPC2 n=1 Tax=Mus musculus RepID=RPC2_MOUSE Length = 1133 Score = 49.7 bits (117), Expect(2) = 2e-06 Identities = 21/27 (77%), Positives = 26/27 (96%) Frame = -3 Query: 312 NMKLPYACKLLIQELQSMNIVPRLKLA 232 ++++PYACKLL QELQSMNI+PRLKLA Sbjct: 1103 SLRIPYACKLLFQELQSMNIIPRLKLA 1129 Score = 25.0 bits (53), Expect(2) = 2e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 413 QVQVCRSCGLLGY 375 +V VC CGLLGY Sbjct: 1076 EVDVCGQCGLLGY 1088 [18][TOP] >UniRef100_UPI0000ECD29F DNA-directed RNA polymerase III subunit RPC2 (EC 2.7.7.6) (RNA polymerase III subunit C2) (DNA-directed RNA polymerase III subunit B) (DNA-directed RNA polymerase III 127.6 kDa polypeptide) (C128). n=1 Tax=Gallus gallus RepID=UPI0000ECD29F Length = 1132 Score = 49.7 bits (117), Expect(2) = 2e-06 Identities = 21/27 (77%), Positives = 26/27 (96%) Frame = -3 Query: 312 NMKLPYACKLLIQELQSMNIVPRLKLA 232 ++++PYACKLL QELQSMNI+PRLKLA Sbjct: 1102 SLRIPYACKLLFQELQSMNIIPRLKLA 1128 Score = 25.0 bits (53), Expect(2) = 2e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 413 QVQVCRSCGLLGY 375 +V VC CGLLGY Sbjct: 1075 EVDVCGQCGLLGY 1087 [19][TOP] >UniRef100_A2BG99 DNA-directed RNA polymerase n=1 Tax=Danio rerio RepID=A2BG99_DANRE Length = 1130 Score = 49.7 bits (117), Expect(2) = 2e-06 Identities = 21/27 (77%), Positives = 26/27 (96%) Frame = -3 Query: 312 NMKLPYACKLLIQELQSMNIVPRLKLA 232 ++++PYACKLL QELQSMNI+PRLKLA Sbjct: 1100 SLRIPYACKLLFQELQSMNIIPRLKLA 1126 Score = 25.0 bits (53), Expect(2) = 2e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 413 QVQVCRSCGLLGY 375 +V VC CGLLGY Sbjct: 1073 EVDVCGQCGLLGY 1085 [20][TOP] >UniRef100_UPI0000E7F911 PREDICTED: similar to Polymerase (RNA) III (DNA directed) polypeptide B n=1 Tax=Gallus gallus RepID=UPI0000E7F911 Length = 1126 Score = 49.7 bits (117), Expect(2) = 2e-06 Identities = 21/27 (77%), Positives = 26/27 (96%) Frame = -3 Query: 312 NMKLPYACKLLIQELQSMNIVPRLKLA 232 ++++PYACKLL QELQSMNI+PRLKLA Sbjct: 1096 SLRIPYACKLLFQELQSMNIIPRLKLA 1122 Score = 25.0 bits (53), Expect(2) = 2e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 413 QVQVCRSCGLLGY 375 +V VC CGLLGY Sbjct: 1069 EVDVCGQCGLLGY 1081 [21][TOP] >UniRef100_UPI00006A103B DNA-directed RNA polymerase III subunit RPC2 (EC 2.7.7.6) (RNA polymerase III subunit C2) (DNA-directed RNA polymerase III subunit B) (DNA-directed RNA polymerase III 127.6 kDa polypeptide) (C128). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI00006A103B Length = 1122 Score = 49.7 bits (117), Expect(2) = 2e-06 Identities = 21/27 (77%), Positives = 26/27 (96%) Frame = -3 Query: 312 NMKLPYACKLLIQELQSMNIVPRLKLA 232 ++++PYACKLL QELQSMNI+PRLKLA Sbjct: 1092 SLRIPYACKLLFQELQSMNIIPRLKLA 1118 Score = 25.0 bits (53), Expect(2) = 2e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 413 QVQVCRSCGLLGY 375 +V VC CGLLGY Sbjct: 1065 EVDVCGKCGLLGY 1077 [22][TOP] >UniRef100_C0PUS9 DNA-directed RNA polymerase (Fragment) n=1 Tax=Salmo salar RepID=C0PUS9_SALSA Length = 814 Score = 49.7 bits (117), Expect(2) = 2e-06 Identities = 21/27 (77%), Positives = 26/27 (96%) Frame = -3 Query: 312 NMKLPYACKLLIQELQSMNIVPRLKLA 232 ++++PYACKLL QELQSMNI+PRLKLA Sbjct: 784 SLRIPYACKLLFQELQSMNIIPRLKLA 810 Score = 25.0 bits (53), Expect(2) = 2e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 413 QVQVCRSCGLLGY 375 +V VC CGLLGY Sbjct: 757 EVDVCGQCGLLGY 769 [23][TOP] >UniRef100_Q9CSL3 Putative uncharacterized protein (Fragment) n=1 Tax=Mus musculus RepID=Q9CSL3_MOUSE Length = 112 Score = 49.7 bits (117), Expect(2) = 3e-06 Identities = 21/27 (77%), Positives = 26/27 (96%) Frame = -3 Query: 312 NMKLPYACKLLIQELQSMNIVPRLKLA 232 ++++PYACKLL QELQSMNI+PRLKLA Sbjct: 82 SLRIPYACKLLFQELQSMNIIPRLKLA 108 Score = 25.0 bits (53), Expect(2) = 3e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 413 QVQVCRSCGLLGY 375 +V VC CGLLGY Sbjct: 55 EVDVCGQCGLLGY 67 [24][TOP] >UniRef100_B9WLY1 DNA-directed RNA polymerase n=1 Tax=Candida dubliniensis CD36 RepID=B9WLY1_CANDC Length = 1157 Score = 46.2 bits (108), Expect(2) = 5e-06 Identities = 23/43 (53%), Positives = 26/43 (60%) Frame = -3 Query: 357 NWCLSITLRMETRFPNMKLPYACKLLIQELQSMNIVPRLKLAD 229 NWC T + M +PYA KLL QEL SMNI PRL+L D Sbjct: 1115 NWCT--TCKSSENVIKMTIPYAAKLLFQELLSMNIAPRLRLGD 1155 Score = 27.3 bits (59), Expect(2) = 5e-06 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -1 Query: 413 QVQVCRSCGLLGYYNY 366 +V VC CGL+GY N+ Sbjct: 1101 EVDVCNKCGLMGYNNW 1116 [25][TOP] >UniRef100_UPI00017B31AA UPI00017B31AA related cluster n=1 Tax=Tetraodon nigroviridis RepID=UPI00017B31AA Length = 1153 Score = 48.5 bits (114), Expect(2) = 5e-06 Identities = 20/27 (74%), Positives = 26/27 (96%) Frame = -3 Query: 312 NMKLPYACKLLIQELQSMNIVPRLKLA 232 ++++PYACKLL QELQSMNI+PRLKL+ Sbjct: 1127 SLRIPYACKLLFQELQSMNIIPRLKLS 1153 Score = 25.0 bits (53), Expect(2) = 5e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 413 QVQVCRSCGLLGY 375 +V VC CGLLGY Sbjct: 1100 EVDVCGQCGLLGY 1112 [26][TOP] >UniRef100_UPI0001560749 PREDICTED: similar to DNA-directed RNA polymerase III subunit RPC2 (RNA polymerase III subunit C2) (DNA-directed RNA polymerase III subunit B) (DNA-directed RNA polymerase III 127.6 kDa polypeptide) (C128) n=1 Tax=Equus caballus RepID=UPI0001560749 Length = 1133 Score = 48.5 bits (114), Expect(2) = 5e-06 Identities = 20/27 (74%), Positives = 26/27 (96%) Frame = -3 Query: 312 NMKLPYACKLLIQELQSMNIVPRLKLA 232 ++++PYACKLL QELQSMNI+PRLKL+ Sbjct: 1103 SLRIPYACKLLFQELQSMNIIPRLKLS 1129 Score = 25.0 bits (53), Expect(2) = 5e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 413 QVQVCRSCGLLGY 375 +V VC CGLLGY Sbjct: 1076 EVDVCGQCGLLGY 1088 [27][TOP] >UniRef100_UPI0000E23379 PREDICTED: polymerase (RNA) III (DNA directed) polypeptide B isoform 2 n=1 Tax=Pan troglodytes RepID=UPI0000E23379 Length = 1133 Score = 48.5 bits (114), Expect(2) = 5e-06 Identities = 20/27 (74%), Positives = 26/27 (96%) Frame = -3 Query: 312 NMKLPYACKLLIQELQSMNIVPRLKLA 232 ++++PYACKLL QELQSMNI+PRLKL+ Sbjct: 1103 SLRIPYACKLLFQELQSMNIIPRLKLS 1129 Score = 25.0 bits (53), Expect(2) = 5e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 413 QVQVCRSCGLLGY 375 +V VC CGLLGY Sbjct: 1076 EVDVCGQCGLLGY 1088 [28][TOP] >UniRef100_UPI00005EAC23 PREDICTED: similar to Polymerase (RNA) III (DNA directed) polypeptide B n=1 Tax=Monodelphis domestica RepID=UPI00005EAC23 Length = 1133 Score = 48.5 bits (114), Expect(2) = 5e-06 Identities = 20/27 (74%), Positives = 26/27 (96%) Frame = -3 Query: 312 NMKLPYACKLLIQELQSMNIVPRLKLA 232 ++++PYACKLL QELQSMNI+PRLKL+ Sbjct: 1103 SLRIPYACKLLFQELQSMNIIPRLKLS 1129 Score = 25.0 bits (53), Expect(2) = 5e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 413 QVQVCRSCGLLGY 375 +V VC CGLLGY Sbjct: 1076 EVDVCGQCGLLGY 1088 [29][TOP] >UniRef100_UPI00005A223E PREDICTED: similar to DNA-directed RNA polymerase III subunit 127.6 kDa polypeptide (RNA polymerase III subunit 2) (RPC2) n=1 Tax=Canis lupus familiaris RepID=UPI00005A223E Length = 1133 Score = 48.5 bits (114), Expect(2) = 5e-06 Identities = 20/27 (74%), Positives = 26/27 (96%) Frame = -3 Query: 312 NMKLPYACKLLIQELQSMNIVPRLKLA 232 ++++PYACKLL QELQSMNI+PRLKL+ Sbjct: 1103 SLRIPYACKLLFQELQSMNIIPRLKLS 1129 Score = 25.0 bits (53), Expect(2) = 5e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 413 QVQVCRSCGLLGY 375 +V VC CGLLGY Sbjct: 1076 EVDVCGQCGLLGY 1088 [30][TOP] >UniRef100_UPI0000F339C2 PREDICTED: similar to DNA-directed RNA polymerase III subunit RPC2 (RNA polymerase III subunit C2) (DNA-directed RNA polymerase III subunit B) (DNA-directed RNA polymerase III 127.6 kDa polypeptide) (C128) n=1 Tax=Bos taurus RepID=UPI0000F339C2 Length = 1133 Score = 48.5 bits (114), Expect(2) = 5e-06 Identities = 20/27 (74%), Positives = 26/27 (96%) Frame = -3 Query: 312 NMKLPYACKLLIQELQSMNIVPRLKLA 232 ++++PYACKLL QELQSMNI+PRLKL+ Sbjct: 1103 SLRIPYACKLLFQELQSMNIIPRLKLS 1129 Score = 25.0 bits (53), Expect(2) = 5e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 413 QVQVCRSCGLLGY 375 +V VC CGLLGY Sbjct: 1076 EVDVCGQCGLLGY 1088 [31][TOP] >UniRef100_Q7Z3R8 DNA-directed RNA polymerase n=2 Tax=Homininae RepID=Q7Z3R8_HUMAN Length = 1133 Score = 48.5 bits (114), Expect(2) = 5e-06 Identities = 20/27 (74%), Positives = 26/27 (96%) Frame = -3 Query: 312 NMKLPYACKLLIQELQSMNIVPRLKLA 232 ++++PYACKLL QELQSMNI+PRLKL+ Sbjct: 1103 SLRIPYACKLLFQELQSMNIIPRLKLS 1129 Score = 25.0 bits (53), Expect(2) = 5e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 413 QVQVCRSCGLLGY 375 +V VC CGLLGY Sbjct: 1076 EVDVCGQCGLLGY 1088 [32][TOP] >UniRef100_Q9NW08 DNA-directed RNA polymerase III subunit RPC2 n=2 Tax=Homo sapiens RepID=RPC2_HUMAN Length = 1133 Score = 48.5 bits (114), Expect(2) = 5e-06 Identities = 20/27 (74%), Positives = 26/27 (96%) Frame = -3 Query: 312 NMKLPYACKLLIQELQSMNIVPRLKLA 232 ++++PYACKLL QELQSMNI+PRLKL+ Sbjct: 1103 SLRIPYACKLLFQELQSMNIIPRLKLS 1129 Score = 25.0 bits (53), Expect(2) = 5e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 413 QVQVCRSCGLLGY 375 +V VC CGLLGY Sbjct: 1076 EVDVCGQCGLLGY 1088 [33][TOP] >UniRef100_UPI00017B31A9 UPI00017B31A9 related cluster n=1 Tax=Tetraodon nigroviridis RepID=UPI00017B31A9 Length = 1132 Score = 48.5 bits (114), Expect(2) = 5e-06 Identities = 20/27 (74%), Positives = 26/27 (96%) Frame = -3 Query: 312 NMKLPYACKLLIQELQSMNIVPRLKLA 232 ++++PYACKLL QELQSMNI+PRLKL+ Sbjct: 1102 SLRIPYACKLLFQELQSMNIIPRLKLS 1128 Score = 25.0 bits (53), Expect(2) = 5e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 413 QVQVCRSCGLLGY 375 +V VC CGLLGY Sbjct: 1075 EVDVCGQCGLLGY 1087 [34][TOP] >UniRef100_UPI00016E4F57 UPI00016E4F57 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E4F57 Length = 1132 Score = 48.5 bits (114), Expect(2) = 5e-06 Identities = 20/27 (74%), Positives = 26/27 (96%) Frame = -3 Query: 312 NMKLPYACKLLIQELQSMNIVPRLKLA 232 ++++PYACKLL QELQSMNI+PRLKL+ Sbjct: 1102 SLRIPYACKLLFQELQSMNIIPRLKLS 1128 Score = 25.0 bits (53), Expect(2) = 5e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 413 QVQVCRSCGLLGY 375 +V VC CGLLGY Sbjct: 1075 EVDVCGQCGLLGY 1087 [35][TOP] >UniRef100_UPI00016E4F58 UPI00016E4F58 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E4F58 Length = 1118 Score = 48.5 bits (114), Expect(2) = 5e-06 Identities = 20/27 (74%), Positives = 26/27 (96%) Frame = -3 Query: 312 NMKLPYACKLLIQELQSMNIVPRLKLA 232 ++++PYACKLL QELQSMNI+PRLKL+ Sbjct: 1088 SLRIPYACKLLFQELQSMNIIPRLKLS 1114 Score = 25.0 bits (53), Expect(2) = 5e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 413 QVQVCRSCGLLGY 375 +V VC CGLLGY Sbjct: 1061 EVDVCGQCGLLGY 1073 [36][TOP] >UniRef100_Q5NVB0 Putative uncharacterized protein DKFZp469K1717 n=1 Tax=Pongo abelii RepID=Q5NVB0_PONAB Length = 1116 Score = 48.5 bits (114), Expect(2) = 5e-06 Identities = 20/27 (74%), Positives = 26/27 (96%) Frame = -3 Query: 312 NMKLPYACKLLIQELQSMNIVPRLKLA 232 ++++PYACKLL QELQSMNI+PRLKL+ Sbjct: 1086 SLRIPYACKLLFQELQSMNIIPRLKLS 1112 Score = 25.0 bits (53), Expect(2) = 5e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 413 QVQVCRSCGLLGY 375 +V VC CGLLGY Sbjct: 1059 EVDVCGQCGLLGY 1071 [37][TOP] >UniRef100_UPI000155CB1A PREDICTED: similar to Polymerase (RNA) III (DNA directed) polypeptide B n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155CB1A Length = 1113 Score = 48.5 bits (114), Expect(2) = 5e-06 Identities = 20/27 (74%), Positives = 26/27 (96%) Frame = -3 Query: 312 NMKLPYACKLLIQELQSMNIVPRLKLA 232 ++++PYACKLL QELQSMNI+PRLKL+ Sbjct: 1083 SLRIPYACKLLFQELQSMNIIPRLKLS 1109 Score = 25.0 bits (53), Expect(2) = 5e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 413 QVQVCRSCGLLGY 375 +V VC CGLLGY Sbjct: 1056 EVDVCGQCGLLGY 1068 [38][TOP] >UniRef100_B3KV73 DNA-directed RNA polymerase n=1 Tax=Homo sapiens RepID=B3KV73_HUMAN Length = 1075 Score = 48.5 bits (114), Expect(2) = 5e-06 Identities = 20/27 (74%), Positives = 26/27 (96%) Frame = -3 Query: 312 NMKLPYACKLLIQELQSMNIVPRLKLA 232 ++++PYACKLL QELQSMNI+PRLKL+ Sbjct: 1045 SLRIPYACKLLFQELQSMNIIPRLKLS 1071 Score = 25.0 bits (53), Expect(2) = 5e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 413 QVQVCRSCGLLGY 375 +V VC CGLLGY Sbjct: 1018 EVDVCGQCGLLGY 1030 [39][TOP] >UniRef100_B3KRQ8 DNA-directed RNA polymerase n=1 Tax=Homo sapiens RepID=B3KRQ8_HUMAN Length = 838 Score = 48.5 bits (114), Expect(2) = 5e-06 Identities = 20/27 (74%), Positives = 26/27 (96%) Frame = -3 Query: 312 NMKLPYACKLLIQELQSMNIVPRLKLA 232 ++++PYACKLL QELQSMNI+PRLKL+ Sbjct: 808 SLRIPYACKLLFQELQSMNIIPRLKLS 834 Score = 25.0 bits (53), Expect(2) = 5e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 413 QVQVCRSCGLLGY 375 +V VC CGLLGY Sbjct: 781 EVDVCGQCGLLGY 793 [40][TOP] >UniRef100_UPI000179EFE0 UPI000179EFE0 related cluster n=1 Tax=Bos taurus RepID=UPI000179EFE0 Length = 796 Score = 48.5 bits (114), Expect(2) = 5e-06 Identities = 20/27 (74%), Positives = 26/27 (96%) Frame = -3 Query: 312 NMKLPYACKLLIQELQSMNIVPRLKLA 232 ++++PYACKLL QELQSMNI+PRLKL+ Sbjct: 766 SLRIPYACKLLFQELQSMNIIPRLKLS 792 Score = 25.0 bits (53), Expect(2) = 5e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 413 QVQVCRSCGLLGY 375 +V VC CGLLGY Sbjct: 739 EVDVCGQCGLLGY 751 [41][TOP] >UniRef100_B3KQY9 DNA-directed RNA polymerase n=1 Tax=Homo sapiens RepID=B3KQY9_HUMAN Length = 523 Score = 48.5 bits (114), Expect(2) = 5e-06 Identities = 20/27 (74%), Positives = 26/27 (96%) Frame = -3 Query: 312 NMKLPYACKLLIQELQSMNIVPRLKLA 232 ++++PYACKLL QELQSMNI+PRLKL+ Sbjct: 493 SLRIPYACKLLFQELQSMNIIPRLKLS 519 Score = 25.0 bits (53), Expect(2) = 5e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 413 QVQVCRSCGLLGY 375 +V VC CGLLGY Sbjct: 466 EVDVCGQCGLLGY 478 [42][TOP] >UniRef100_Q54IZ9 Ddi rpc2 intein n=1 Tax=Dictyostelium discoideum RepID=RPC2_DICDI Length = 1608 Score = 48.5 bits (114), Expect(2) = 7e-06 Identities = 21/27 (77%), Positives = 25/27 (92%) Frame = -3 Query: 309 MKLPYACKLLIQELQSMNIVPRLKLAD 229 +++PYACKLL QELQ+MNIVPRLKL D Sbjct: 1581 IQIPYACKLLFQELQAMNIVPRLKLVD 1607 Score = 24.6 bits (52), Expect(2) = 7e-06 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -1 Query: 410 VQVCRSCGLLGYYNY 366 V C++CG LGY Y Sbjct: 1554 VYACKNCGFLGYEGY 1568 [43][TOP] >UniRef100_C5M3E6 DNA-directed RNA polymerase n=1 Tax=Candida tropicalis MYA-3404 RepID=C5M3E6_CANTT Length = 1159 Score = 45.8 bits (107), Expect(2) = 7e-06 Identities = 23/43 (53%), Positives = 26/43 (60%) Frame = -3 Query: 357 NWCLSITLRMETRFPNMKLPYACKLLIQELQSMNIVPRLKLAD 229 NWC T + M +PYA KLL QEL SMNI PRL+L D Sbjct: 1117 NWCT--TCQSSENVIKMTIPYAAKLLFQELLSMNIAPRLRLGD 1157 Score = 27.3 bits (59), Expect(2) = 7e-06 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -1 Query: 413 QVQVCRSCGLLGYYNY 366 +V VC CGL+GY N+ Sbjct: 1103 EVDVCNKCGLMGYNNW 1118 [44][TOP] >UniRef100_Q27492 DNA-directed RNA polymerase n=1 Tax=Caenorhabditis elegans RepID=Q27492_CAEEL Length = 1154 Score = 52.8 bits (125), Expect(2) = 7e-06 Identities = 26/43 (60%), Positives = 29/43 (67%) Frame = -3 Query: 360 ENWCLSITLRMETRFPNMKLPYACKLLIQELQSMNIVPRLKLA 232 + WC R N+K+PYACKLL QELQSMNIVPRL LA Sbjct: 1110 KGWCQKC--RSSKSMANIKIPYACKLLFQELQSMNIVPRLDLA 1150 Score = 20.4 bits (41), Expect(2) = 7e-06 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -1 Query: 413 QVQVCRSCGLLG 378 +V VC CG++G Sbjct: 1097 KVDVCTGCGVIG 1108 [45][TOP] >UniRef100_B6VBN7 DNA-directed RNA polymerase n=1 Tax=Caenorhabditis brenneri RepID=B6VBN7_CAEBE Length = 1152 Score = 52.8 bits (125), Expect(2) = 7e-06 Identities = 26/43 (60%), Positives = 29/43 (67%) Frame = -3 Query: 360 ENWCLSITLRMETRFPNMKLPYACKLLIQELQSMNIVPRLKLA 232 + WC R N+K+PYACKLL QELQSMNIVPRL LA Sbjct: 1108 KGWCQKC--RSSKSMANIKIPYACKLLFQELQSMNIVPRLDLA 1148 Score = 20.4 bits (41), Expect(2) = 7e-06 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -1 Query: 413 QVQVCRSCGLLG 378 +V VC CG++G Sbjct: 1095 KVDVCTGCGVIG 1106 [46][TOP] >UniRef100_C3YYC3 DNA-directed RNA polymerase n=1 Tax=Branchiostoma floridae RepID=C3YYC3_BRAFL Length = 1137 Score = 48.1 bits (113), Expect(2) = 7e-06 Identities = 21/26 (80%), Positives = 24/26 (92%) Frame = -3 Query: 312 NMKLPYACKLLIQELQSMNIVPRLKL 235 ++K+PYACKLL QELQSMNI PRLKL Sbjct: 1107 SLKMPYACKLLFQELQSMNIAPRLKL 1132 Score = 25.0 bits (53), Expect(2) = 7e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 413 QVQVCRSCGLLGY 375 +V VC CGLLGY Sbjct: 1080 EVDVCGECGLLGY 1092 [47][TOP] >UniRef100_B8BQM2 DNA-directed RNA polymerase n=1 Tax=Thalassiosira pseudonana CCMP1335 RepID=B8BQM2_THAPS Length = 1108 Score = 53.5 bits (127), Expect = 7e-06 Identities = 31/70 (44%), Positives = 44/70 (62%) Frame = -3 Query: 438 LMLFSDPFASSGL*IVWVVRILQL*VENWCLSITLRMETRFPNMKLPYACKLLIQELQSM 259 LM SD F++S + +LQ +NWC R + +++LPYACKLL QELQ+M Sbjct: 1045 LMHSSDAFSAS---VCMTCGLLQY--QNWCQYC--RSGEKVSDIRLPYACKLLFQELQAM 1097 Query: 258 NIVPRLKLAD 229 N++PRL+L D Sbjct: 1098 NVLPRLRLKD 1107 [48][TOP] >UniRef100_C1N4K3 DNA-directed RNA polymerase n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1N4K3_9CHLO Length = 1197 Score = 48.5 bits (114), Expect(2) = 9e-06 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = -3 Query: 309 MKLPYACKLLIQELQSMNIVPRLKLAD 229 +KLPYACKLL QELQSMNI PRL L+D Sbjct: 1170 LKLPYACKLLFQELQSMNICPRLTLSD 1196 Score = 24.3 bits (51), Expect(2) = 9e-06 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -1 Query: 413 QVQVCRSCGLLGYYNY 366 + QVC CGLL Y ++ Sbjct: 1137 EAQVCNKCGLLAYRHH 1152