[UP]
[1][TOP]
>UniRef100_Q9XFC1 Stearoyl acyl carrier protein desaturase Lldd3A20 n=1 Tax=Lupinus
luteus RepID=Q9XFC1_LUPLU
Length = 384
Score = 65.1 bits (157), Expect = 2e-09
Identities = 29/34 (85%), Positives = 31/34 (91%)
Frame = -1
Query: 421 PRIRRLQERADERARKMKPQGVKFSWIFNNEVVL 320
PRIRRLQERADERARKMKP VKFSWIFN E++L
Sbjct: 351 PRIRRLQERADERARKMKPHAVKFSWIFNKEIIL 384
[2][TOP]
>UniRef100_A7NSK4 Acyl-[acyl-carrier-protein] desaturase n=1 Tax=Vitis vinifera
RepID=A7NSK4_VITVI
Length = 389
Score = 62.0 bits (149), Expect = 2e-08
Identities = 28/34 (82%), Positives = 30/34 (88%)
Frame = -1
Query: 421 PRIRRLQERADERARKMKPQGVKFSWIFNNEVVL 320
PRIR+LQERADERARKM PQG +FSWIFN EV L
Sbjct: 356 PRIRKLQERADERARKMGPQGARFSWIFNKEVAL 389
[3][TOP]
>UniRef100_B5AY36 Acyl-[acyl-carrier-protein] desaturase n=1 Tax=Ricinus communis
RepID=B5AY36_RICCO
Length = 391
Score = 61.6 bits (148), Expect = 3e-08
Identities = 28/34 (82%), Positives = 30/34 (88%)
Frame = -1
Query: 421 PRIRRLQERADERARKMKPQGVKFSWIFNNEVVL 320
PRIR+LQERADERA+KMKPQ KFSWIFN EV L
Sbjct: 358 PRIRKLQERADERAKKMKPQSAKFSWIFNREVPL 391
[4][TOP]
>UniRef100_B9H7N5 Acyl-[acyl-carrier-protein] desaturase n=1 Tax=Populus trichocarpa
RepID=B9H7N5_POPTR
Length = 377
Score = 58.5 bits (140), Expect = 2e-07
Identities = 26/34 (76%), Positives = 29/34 (85%)
Frame = -1
Query: 421 PRIRRLQERADERARKMKPQGVKFSWIFNNEVVL 320
PRIRRLQERADE+A+KMKP +FSWIFN EV L
Sbjct: 344 PRIRRLQERADEKAKKMKPLSARFSWIFNKEVAL 377
[5][TOP]
>UniRef100_Q6SRZ5 Acyl-[acyl-carrier-protein] desaturase n=1 Tax=Carica papaya
RepID=Q6SRZ5_CARPA
Length = 385
Score = 58.2 bits (139), Expect = 3e-07
Identities = 26/34 (76%), Positives = 30/34 (88%)
Frame = -1
Query: 421 PRIRRLQERADERARKMKPQGVKFSWIFNNEVVL 320
PRIR+LQERADERA+KM+P KFSWIFN EV+L
Sbjct: 352 PRIRKLQERADERAKKMEPHYAKFSWIFNKEVLL 385
[6][TOP]
>UniRef100_A1YNA1 Acyl-[acyl-carrier-protein] desaturase n=1 Tax=Glycine max
RepID=A1YNA1_SOYBN
Length = 386
Score = 58.2 bits (139), Expect = 3e-07
Identities = 29/35 (82%), Positives = 31/35 (88%), Gaps = 1/35 (2%)
Frame = -1
Query: 421 PRIRRLQERADERARKMKP-QGVKFSWIFNNEVVL 320
PRIRRLQERADERARKMK GVKFSWIFN E++L
Sbjct: 352 PRIRRLQERADERARKMKKHHGVKFSWIFNKELLL 386
[7][TOP]
>UniRef100_A1YNA0 Acyl-[acyl-carrier-protein] desaturase n=1 Tax=Glycine max
RepID=A1YNA0_SOYBN
Length = 386
Score = 58.2 bits (139), Expect = 3e-07
Identities = 29/35 (82%), Positives = 31/35 (88%), Gaps = 1/35 (2%)
Frame = -1
Query: 421 PRIRRLQERADERARKMKP-QGVKFSWIFNNEVVL 320
PRIRRLQERADERARKMK GVKFSWIFN E++L
Sbjct: 352 PRIRRLQERADERARKMKKHHGVKFSWIFNKELLL 386