[UP]
[1][TOP] >UniRef100_B7FIY1 Putative uncharacterized protein n=1 Tax=Medicago truncatula RepID=B7FIY1_MEDTR Length = 263 Score = 86.3 bits (212), Expect = 1e-15 Identities = 44/65 (67%), Positives = 44/65 (67%), Gaps = 11/65 (16%) Frame = -1 Query: 436 PQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPAT-----------GYPPAAYPPPGYPP 290 P P G APQPA YGQ YGYPPAPPPAQGYPAT GYPP AYPP GYPP Sbjct: 201 PVPPSVGY-APQPA-YGQNYGYPPAPPPAQGYPATGYPSAAYPPQQGYPPTAYPPQGYPP 258 Query: 289 SGYSR 275 SGYSR Sbjct: 259 SGYSR 263 [2][TOP] >UniRef100_A9PCV7 Putative uncharacterized protein n=1 Tax=Populus trichocarpa RepID=A9PCV7_POPTR Length = 253 Score = 75.9 bits (185), Expect = 1e-12 Identities = 36/56 (64%), Positives = 38/56 (67%) Frame = -1 Query: 442 YAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 275 YAPQ YGQP YGQPYGYPP P QGYP GYPP+ YPPP YPPSGY + Sbjct: 208 YAPQT--YGQP------YGQPYGYPPQPH--QGYPVAGYPPSNYPPPAYPPSGYPK 253 [3][TOP] >UniRef100_B9GKE8 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GKE8_POPTR Length = 94 Score = 70.9 bits (172), Expect = 4e-11 Identities = 33/52 (63%), Positives = 34/52 (65%) Frame = -1 Query: 430 PAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 275 P G P P YGQPYGYPP AQGYPA GYPP AYPP YPPSGY + Sbjct: 49 PPSVGYP---PQGYGQPYGYPPQ---AQGYPAAGYPPPAYPPSNYPPSGYPK 94 [4][TOP] >UniRef100_A9PIT6 Putative uncharacterized protein n=1 Tax=Populus trichocarpa x Populus deltoides RepID=A9PIT6_9ROSI Length = 248 Score = 70.9 bits (172), Expect = 4e-11 Identities = 33/52 (63%), Positives = 34/52 (65%) Frame = -1 Query: 430 PAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 275 P G P P YGQPYGYPP AQGYPA GYPP AYPP YPPSGY + Sbjct: 203 PPSVGYP---PQGYGQPYGYPPQ---AQGYPAAGYPPPAYPPSNYPPSGYPK 248 [5][TOP] >UniRef100_C6SXX5 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6SXX5_SOYBN Length = 248 Score = 69.7 bits (169), Expect = 9e-11 Identities = 36/56 (64%), Positives = 37/56 (66%) Frame = -1 Query: 442 YAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 275 YAPQPA YGQPA GYP A GYP TGYPPAAYPPPGYPPSGY + Sbjct: 208 YAPQPA-YGQPAQ---------GYP-----APGYPPTGYPPAAYPPPGYPPSGYPK 248 [6][TOP] >UniRef100_A9RJ18 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RJ18_PHYPA Length = 377 Score = 68.9 bits (167), Expect = 2e-10 Identities = 35/61 (57%), Positives = 37/61 (60%), Gaps = 5/61 (8%) Frame = -1 Query: 442 YAPQPA--PYGQPAPQPA---PYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYS 278 Y PQ P G P PQ P G P GYPPA P GYP +GYPP+ YPP GYPPSGY Sbjct: 210 YPPQQGYPPQGYP-PQGGHAYPPGAPAGYPPAGYPPAGYPPSGYPPSGYPPSGYPPSGYP 268 Query: 277 R 275 R Sbjct: 269 R 269 [7][TOP] >UniRef100_Q8H8G4 Putative uncharacterized protein OJ1126B12.17 n=1 Tax=Oryza sativa Japonica Group RepID=Q8H8G4_ORYSJ Length = 241 Score = 67.4 bits (163), Expect = 5e-10 Identities = 38/59 (64%), Positives = 38/59 (64%), Gaps = 8/59 (13%) Frame = -1 Query: 436 PQPAPYGQPAPQPAPYGQPYG-YPPAPPPAQGYPATGYPPA------AYPPPG-YPPSG 284 P P P G QPA YGQPYG YPPAPP AQGYP YPPA AYPPPG YPP G Sbjct: 168 PIPPPVGYTPQQPA-YGQPYGGYPPAPP-AQGYPPAAYPPAGYPQGGAYPPPGSYPPPG 224 [8][TOP] >UniRef100_Q10SG5 Os03g0123600 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q10SG5_ORYSJ Length = 274 Score = 67.4 bits (163), Expect = 5e-10 Identities = 38/59 (64%), Positives = 38/59 (64%), Gaps = 8/59 (13%) Frame = -1 Query: 436 PQPAPYGQPAPQPAPYGQPYG-YPPAPPPAQGYPATGYPPA------AYPPPG-YPPSG 284 P P P G QPA YGQPYG YPPAPP AQGYP YPPA AYPPPG YPP G Sbjct: 201 PIPPPVGYTPQQPA-YGQPYGGYPPAPP-AQGYPPAAYPPAGYPQGGAYPPPGSYPPPG 257 [9][TOP] >UniRef100_B8ALY9 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8ALY9_ORYSI Length = 274 Score = 67.4 bits (163), Expect = 5e-10 Identities = 38/59 (64%), Positives = 38/59 (64%), Gaps = 8/59 (13%) Frame = -1 Query: 436 PQPAPYGQPAPQPAPYGQPYG-YPPAPPPAQGYPATGYPPA------AYPPPG-YPPSG 284 P P P G QPA YGQPYG YPPAPP AQGYP YPPA AYPPPG YPP G Sbjct: 201 PIPPPVGYTPQQPA-YGQPYGGYPPAPP-AQGYPPAAYPPAGYPQGGAYPPPGSYPPPG 257 [10][TOP] >UniRef100_B9RDV3 Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9RDV3_RICCO Length = 248 Score = 67.0 bits (162), Expect = 6e-10 Identities = 35/55 (63%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = -1 Query: 436 PQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPG-YPPSGYSR 275 P P P G P PQPA YG PP PP AQGYP GYPP YPPPG YPPSGY + Sbjct: 201 PIPPPIGYP-PQPA-----YGQPP-PPYAQGYPPAGYPPPQYPPPGAYPPSGYPK 248 [11][TOP] >UniRef100_B4N6T9 GK24096 n=1 Tax=Drosophila willistoni RepID=B4N6T9_DROWI Length = 536 Score = 66.2 bits (160), Expect = 1e-09 Identities = 32/55 (58%), Positives = 33/55 (60%), Gaps = 4/55 (7%) Frame = -1 Query: 439 APQPAPYGQPAPQPAPYGQP---YGYPPAPPPAQGY-PATGYPPAAYPPPGYPPS 287 AP P P P PQ Y P YGYPP PPP QGY PA GYPP AY PP PP+ Sbjct: 19 APPPQPMVYPPPQYEGYAPPPPQYGYPPQPPPGQGYPPAAGYPPQAYAPPQPPPN 73 [12][TOP] >UniRef100_A9NZ96 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NZ96_PICSI Length = 257 Score = 65.5 bits (158), Expect = 2e-09 Identities = 32/56 (57%), Positives = 35/56 (62%) Frame = -1 Query: 442 YAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 275 Y QP PYGQPA Y QPYGYP Q YPA GYPP+ YP GYPP+GY + Sbjct: 213 YPAQP-PYGQPA-----YPQPYGYP-----TQNYPAQGYPPSGYPSSGYPPAGYKK 257 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/52 (48%), Positives = 25/52 (48%) Frame = -1 Query: 436 PQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 P P Y P PYGQP A P GYP YP YPP GYP SGY Sbjct: 204 PPPVGYAPSYPAQPPYGQP-----AYPQPYGYPTQNYPAQGYPPSGYPSSGY 250 [13][TOP] >UniRef100_A0JMY8 Plscr2 protein n=1 Tax=Xenopus laevis RepID=A0JMY8_XENLA Length = 354 Score = 65.1 bits (157), Expect = 2e-09 Identities = 31/55 (56%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Frame = -1 Query: 442 YAPQPAPYG-QPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 Y P PYG QPA P QP GYPPA GYP GY PA YPP GY P+GY Sbjct: 28 YPPPQNPYGYQPAGYPPAGYQPTGYPPAGYQPAGYPPAGYQPAGYPPAGYQPAGY 82 Score = 60.5 bits (145), Expect = 6e-08 Identities = 29/47 (61%), Positives = 30/47 (63%), Gaps = 1/47 (2%) Frame = -1 Query: 418 GQPAPQPAPYG-QPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 G P PQ PYG QP GYPPA GYP GY PA YPP GY P+GY Sbjct: 27 GYPPPQN-PYGYQPAGYPPAGYQPTGYPPAGYQPAGYPPAGYQPAGY 72 [14][TOP] >UniRef100_B9N0Q7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9N0Q7_POPTR Length = 175 Score = 65.1 bits (157), Expect = 2e-09 Identities = 30/49 (61%), Positives = 31/49 (63%), Gaps = 2/49 (4%) Frame = -1 Query: 421 YGQPA--PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 +G P PQP Y P GYPP P QGYP GYPPA YPP YPPSGY Sbjct: 25 HGAPGYPPQPGAY-PPQGYPPQGYPPQGYPPQGYPPAGYPPGAYPPSGY 72 Score = 63.2 bits (152), Expect = 9e-09 Identities = 30/51 (58%), Positives = 30/51 (58%) Frame = -1 Query: 442 YAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPP 290 Y PQP Y PQ P P GYPP P QGYP GYPP AYPP GYPP Sbjct: 30 YPPQPGAY---PPQGYP---PQGYPPQGYPPQGYPPAGYPPGAYPPSGYPP 74 [15][TOP] >UniRef100_A9P8F5 Putative uncharacterized protein n=1 Tax=Populus trichocarpa RepID=A9P8F5_POPTR Length = 189 Score = 65.1 bits (157), Expect = 2e-09 Identities = 30/49 (61%), Positives = 31/49 (63%), Gaps = 2/49 (4%) Frame = -1 Query: 421 YGQPA--PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 +G P PQP Y P GYPP P QGYP GYPPA YPP YPPSGY Sbjct: 25 HGAPGYPPQPGAY-PPQGYPPQGYPPQGYPPQGYPPAGYPPGAYPPSGY 72 Score = 63.2 bits (152), Expect = 9e-09 Identities = 30/51 (58%), Positives = 30/51 (58%) Frame = -1 Query: 442 YAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPP 290 Y PQP Y PQ P P GYPP P QGYP GYPP AYPP GYPP Sbjct: 30 YPPQPGAY---PPQGYP---PQGYPPQGYPPQGYPPAGYPPGAYPPSGYPP 74 [16][TOP] >UniRef100_Q0D320 Rhodopsin (Fragment) n=1 Tax=Enoploteuthis higginsi RepID=Q0D320_9MOLL Length = 134 Score = 64.7 bits (156), Expect = 3e-09 Identities = 30/46 (65%), Positives = 30/46 (65%), Gaps = 2/46 (4%) Frame = -1 Query: 415 QPAPQPAPYGQPYGYPPA--PPPAQGYPATGYPPAAYPPPGYPPSG 284 Q A QPA Y P GYPP PPP QGYP GYPP YPP GYPP G Sbjct: 78 QQAQQPA-YPPPQGYPPQGYPPPPQGYPPQGYPPQGYPPQGYPPQG 122 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/54 (55%), Positives = 31/54 (57%), Gaps = 2/54 (3%) Frame = -1 Query: 439 APQPAPYGQPAPQPAPYGQPYGYPPAPP--PAQGYPATGYPPAAYPPPGYPPSG 284 A QPA P PQ P P GYPP P P QGYP GYPP YPP G PP+G Sbjct: 80 AQQPA---YPPPQGYP---PQGYPPPPQGYPPQGYPPQGYPPQGYPPQGAPPAG 127 [17][TOP] >UniRef100_Q32L53 Glutamate [NMDA] receptor-associated protein 1 n=1 Tax=Bos taurus RepID=GRINA_BOVIN Length = 366 Score = 64.3 bits (155), Expect = 4e-09 Identities = 33/56 (58%), Positives = 35/56 (62%), Gaps = 3/56 (5%) Frame = -1 Query: 439 APQP-APYGQPAPQPAPYGQPYGYP--PAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 AP P APY Q QP+PYGQP GYP P+P P GYP YPP YP YPP GY Sbjct: 30 APYPGAPYPQAPFQPSPYGQP-GYPQGPSPYPQGGYPQGPYPPGGYPQGPYPPGGY 84 Score = 62.4 bits (150), Expect = 2e-08 Identities = 31/53 (58%), Positives = 33/53 (62%), Gaps = 2/53 (3%) Frame = -1 Query: 433 QPAPYGQPA-PQ-PAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 QP+PYGQP PQ P+PY Q GYP P P GYP YPP YP YPP GY Sbjct: 43 QPSPYGQPGYPQGPSPYPQG-GYPQGPYPPGGYPQGPYPPGGYPQGPYPPGGY 94 [18][TOP] >UniRef100_UPI0001B4FF17 hypothetical protein SvirD4_26967 n=1 Tax=Streptomyces viridochromogenes DSM 40736 RepID=UPI0001B4FF17 Length = 585 Score = 63.9 bits (154), Expect = 5e-09 Identities = 33/63 (52%), Positives = 34/63 (53%), Gaps = 8/63 (12%) Frame = -1 Query: 439 APQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYP----ATGYPPAAYPPPGY----PPSG 284 AP PAPYGQP Q PYGQ G PPP GYP A P A PPPGY PP G Sbjct: 274 APAPAPYGQPGRQQPPYGQAPGQTAPPPPGYGYPQAPQAPQAPQAPAPPPGYGQPTPPPG 333 Query: 283 YSR 275 Y + Sbjct: 334 YGQ 336 [19][TOP] >UniRef100_Q0D316 Rhodopsin (Fragment) n=1 Tax=Megalocranchia fisheri RepID=Q0D316_9MOLL Length = 298 Score = 63.9 bits (154), Expect = 5e-09 Identities = 27/44 (61%), Positives = 27/44 (61%) Frame = -1 Query: 415 QPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 284 Q QPA Y P GYPP P QGYP GYPP YPP GYPP G Sbjct: 240 QQQQQPAGYPPPAGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQG 283 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/45 (60%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -1 Query: 415 QPAPQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 284 QPA P P G P GYPP P QGYP GYPP YPP G PP G Sbjct: 244 QPAGYPPPAGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGAPPQG 288 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/49 (53%), Positives = 27/49 (55%) Frame = -1 Query: 433 QPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPS 287 QPA Y PA P P GYPP P QGYP GYPP PP G PP+ Sbjct: 244 QPAGYPPPAGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGAPPQGAPPA 292 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -1 Query: 385 QPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 QP GYPP PA GYP GYPP YPP GYPP GY Sbjct: 244 QPAGYPP---PA-GYPPQGYPPQGYPPQGYPPQGY 274 [20][TOP] >UniRef100_A9GFP5 Putative membrane protein n=1 Tax=Sorangium cellulosum 'So ce 56' RepID=A9GFP5_SORC5 Length = 263 Score = 63.5 bits (153), Expect = 7e-09 Identities = 36/61 (59%), Positives = 38/61 (62%), Gaps = 8/61 (13%) Frame = -1 Query: 436 PQPAPYGQPAP--QPAPYGQPYGY--PPAPPPAQGY-PATGY--PPAAYPPPGY-PPSGY 281 PQPAP+G PAP PAPYGQ GY PP P GY P GY PP PPPGY PP GY Sbjct: 54 PQPAPHGAPAPYGAPAPYGQQPGYYPPPGYAPPPGYAPPPGYAPPPGYAPPPGYAPPPGY 113 Query: 280 S 278 + Sbjct: 114 A 114 [21][TOP] >UniRef100_P09241 Rhodopsin n=1 Tax=Enteroctopus dofleini RepID=OPSD_ENTDO Length = 455 Score = 63.5 bits (153), Expect = 7e-09 Identities = 32/52 (61%), Positives = 32/52 (61%), Gaps = 2/52 (3%) Frame = -1 Query: 433 QPAPYGQPAPQPAPYGQPYGYPP--APPPAQGYPATGYPPAAYPPPGYPPSG 284 Q A Y QP P P Y P GYPP A PP QGYP GYPP YPP GYPP G Sbjct: 383 QQAAY-QPPPPPQGY-PPQGYPPQGAYPPPQGYPPQGYPPQGYPPQGYPPQG 432 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/54 (50%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Frame = -1 Query: 442 YAPQPAPYGQPA---PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPP 290 Y P P P G P P Y P GYPP QGYP GYPP YPP G PP Sbjct: 387 YQPPPPPQGYPPQGYPPQGAYPPPQGYPP-----QGYPPQGYPPQGYPPQGAPP 435 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/47 (57%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = -1 Query: 415 QPAPQPAPYGQPYGYPPAPPPAQGY--PATGYPPAAYPPPGYPPSGY 281 Q A QP P P GYPP P QG P GYPP YPP GYPP GY Sbjct: 384 QAAYQPPP--PPQGYPPQGYPPQGAYPPPQGYPPQGYPPQGYPPQGY 428 [22][TOP] >UniRef100_UPI00003BE83A hypothetical protein DEHA0G23474g n=1 Tax=Debaryomyces hansenii CBS767 RepID=UPI00003BE83A Length = 440 Score = 63.2 bits (152), Expect = 9e-09 Identities = 29/59 (49%), Positives = 30/59 (50%), Gaps = 5/59 (8%) Frame = -1 Query: 439 APQPAP-----YGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYS 278 AP P P YG P Y P GYPP P QGYP GY P YPP GY P GY+ Sbjct: 14 APPPGPPNGYQYGPPPGAQGQYPPPQGYPPQGYPPQGYPPQGYAPQGYPPQGYAPQGYA 72 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/57 (50%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = -1 Query: 442 YAPQPAPYGQ-PAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 275 Y P P GQ P PQ P P GYPP P QGY GYPP Y P GY P GY + Sbjct: 25 YGPPPGAQGQYPPPQGYP---PQGYPPQGYPPQGYAPQGYPPQGYAPQGYAPQGYQQ 78 Score = 56.6 bits (135), Expect = 8e-07 Identities = 29/51 (56%), Positives = 30/51 (58%), Gaps = 3/51 (5%) Frame = -1 Query: 421 YGQPAPQPAPYGQPYGYPPAPPP-AQGY--PATGYPPAAYPPPGYPPSGYS 278 Y Q AP P P P GY PPP AQG P GYPP YPP GYPP GY+ Sbjct: 10 YRQQAPPPGP---PNGYQYGPPPGAQGQYPPPQGYPPQGYPPQGYPPQGYA 57 [23][TOP] >UniRef100_B9RCF3 Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9RCF3_RICCO Length = 244 Score = 63.2 bits (152), Expect = 9e-09 Identities = 32/54 (59%), Positives = 34/54 (62%), Gaps = 1/54 (1%) Frame = -1 Query: 433 QPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAA-YPPPGYPPSGYSR 275 Q P P A YGQPY AQGYPA+GYPP + YPPPGYPPSGYSR Sbjct: 199 QAIPPSVGYPPQAAYGQPY--------AQGYPASGYPPPSNYPPPGYPPSGYSR 244 [24][TOP] >UniRef100_C4R4X2 Protein involved in positive regulation of both 1,3-beta-glucan synthesis and the Pkc1p-MAPK pathway n=1 Tax=Pichia pastoris GS115 RepID=C4R4X2_PICPG Length = 1338 Score = 63.2 bits (152), Expect = 9e-09 Identities = 30/56 (53%), Positives = 34/56 (60%), Gaps = 2/56 (3%) Frame = -1 Query: 442 YAPQPAPY-GQPAPQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 Y+P+ P G P+ P G P GYPP P QGYP GYPP YPP GYPPSG+ Sbjct: 982 YSPKGYPTEGYPSQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPSGF 1037 Score = 62.0 bits (149), Expect = 2e-08 Identities = 30/60 (50%), Positives = 33/60 (55%), Gaps = 6/60 (10%) Frame = -1 Query: 442 YAPQP-----APYGQPAP-QPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 Y+PQ +P G P P+ P GYPP P QGYP GYPP YPP GYPP GY Sbjct: 973 YSPQANLQEYSPKGYPTEGYPSQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGY 1032 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/48 (56%), Positives = 28/48 (58%) Frame = -1 Query: 424 PYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 P G P PQ P P GYPP P QGYP GYPP YPP G+PP Y Sbjct: 999 PQGYP-PQGYP---PQGYPPQGYPPQGYPPQGYPPQGYPPSGFPPQSY 1042 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/55 (45%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = -1 Query: 442 YAPQPAPYGQPAPQP-APYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 Y PQ P P+ +P Y P P +GYP+ GYPP YPP GYPP GY Sbjct: 958 YPPQNYPPRDYPPRGYSPQANLQEYSPKGYPTEGYPSQGYPPQGYPPQGYPPQGY 1012 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/56 (44%), Positives = 29/56 (51%) Frame = -1 Query: 442 YAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 275 Y PQ P PQ P P GYPP P QGYP GYPP+ +PP YP + + Sbjct: 997 YPPQGYPPQGYPPQGYP---PQGYPPQGYPPQGYPPQGYPPSGFPPQSYPSPSHGQ 1049 [25][TOP] >UniRef100_Q6BH13 Metacaspase-1 n=1 Tax=Debaryomyces hansenii RepID=MCA1_DEBHA Length = 440 Score = 63.2 bits (152), Expect = 9e-09 Identities = 29/59 (49%), Positives = 30/59 (50%), Gaps = 5/59 (8%) Frame = -1 Query: 439 APQPAP-----YGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYS 278 AP P P YG P Y P GYPP P QGYP GY P YPP GY P GY+ Sbjct: 14 APPPGPPNGYQYGPPPGAQGQYPPPQGYPPQGYPPQGYPPQGYAPQGYPPQGYAPQGYA 72 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/57 (50%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = -1 Query: 442 YAPQPAPYGQ-PAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 275 Y P P GQ P PQ P P GYPP P QGY GYPP Y P GY P GY + Sbjct: 25 YGPPPGAQGQYPPPQGYP---PQGYPPQGYPPQGYAPQGYPPQGYAPQGYAPQGYQQ 78 Score = 56.6 bits (135), Expect = 8e-07 Identities = 29/51 (56%), Positives = 30/51 (58%), Gaps = 3/51 (5%) Frame = -1 Query: 421 YGQPAPQPAPYGQPYGYPPAPPP-AQGY--PATGYPPAAYPPPGYPPSGYS 278 Y Q AP P P P GY PPP AQG P GYPP YPP GYPP GY+ Sbjct: 10 YRQQAPPPGP---PNGYQYGPPPGAQGQYPPPQGYPPQGYPPQGYPPQGYA 57 [26][TOP] >UniRef100_UPI0000D57386 PREDICTED: similar to phospholipid scramblase 1, putative n=1 Tax=Tribolium castaneum RepID=UPI0000D57386 Length = 214 Score = 62.4 bits (150), Expect = 2e-08 Identities = 31/57 (54%), Positives = 32/57 (56%), Gaps = 5/57 (8%) Frame = -1 Query: 436 PQPAPYGQPAPQPAPYGQPYGYPP----APPPAQGYPATGYPPAAYPPPG-YPPSGY 281 P P PY P P P GQ YG PP PPP G P GYPP YPPPG YPP G+ Sbjct: 13 PYPTPYNGQYP-PMPPGQGYGTPPPPGYGPPPGYGPPPQGYPPGQYPPPGQYPPPGH 68 [27][TOP] >UniRef100_Q9LF59 Glycine/proline-rich protein n=1 Tax=Arabidopsis thaliana RepID=Q9LF59_ARATH Length = 173 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/48 (60%), Positives = 30/48 (62%), Gaps = 1/48 (2%) Frame = -1 Query: 421 YGQPAPQPAPYGQPYGYPP-APPPAQGYPATGYPPAAYPPPGYPPSGY 281 YG P P P P+GYPP A PP GYP GYPPA YPP GYP GY Sbjct: 39 YGSSYPYPPP-PPPHGYPPVAYPPHGGYPPAGYPPAGYPPAGYPAHGY 85 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/56 (51%), Positives = 31/56 (55%) Frame = -1 Query: 442 YAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 275 Y P P P+G P P+G GYPPA GYP GYPPA YP GYP GY R Sbjct: 45 YPPPPPPHGYPPVAYPPHG---GYPPA-----GYPPAGYPPAGYPAHGYPSHGYPR 92 [28][TOP] >UniRef100_Q0WWS8 Glycine/proline-rich protein n=1 Tax=Arabidopsis thaliana RepID=Q0WWS8_ARATH Length = 173 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/48 (60%), Positives = 30/48 (62%), Gaps = 1/48 (2%) Frame = -1 Query: 421 YGQPAPQPAPYGQPYGYPP-APPPAQGYPATGYPPAAYPPPGYPPSGY 281 YG P P P P+GYPP A PP GYP GYPPA YPP GYP GY Sbjct: 39 YGSSYPYPPP-PPPHGYPPVAYPPHGGYPPAGYPPAGYPPAGYPAHGY 85 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/56 (51%), Positives = 31/56 (55%) Frame = -1 Query: 442 YAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 275 Y P P P+G P P+G GYPPA GYP GYPPA YP GYP GY R Sbjct: 45 YPPPPPPHGYPPVAYPPHG---GYPPA-----GYPPAGYPPAGYPAHGYPSHGYPR 92 [29][TOP] >UniRef100_C0PCD9 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0PCD9_MAIZE Length = 239 Score = 62.4 bits (150), Expect = 2e-08 Identities = 42/80 (52%), Positives = 43/80 (53%), Gaps = 27/80 (33%) Frame = -1 Query: 442 YAPQPAPYGQP-APQPAPYGQPY------GYPPA--------PPPAQGYP-ATGYPP--- 320 YAPQPA YGQP P+P GQ Y GYPPA PPPAQGYP GYPP Sbjct: 90 YAPQPA-YGQPYGGYPSPPGQGYPPPPGQGYPPAGYSQGGAYPPPAQGYPHGGGYPPPGQ 148 Query: 319 -------AAYPPPG-YPPSG 284 AYPPPG YPP G Sbjct: 149 GYPQGQGGAYPPPGSYPPQG 168 Score = 57.4 bits (137), Expect = 5e-07 Identities = 35/67 (52%), Positives = 36/67 (53%), Gaps = 16/67 (23%) Frame = -1 Query: 436 PQPAPYGQPAPQPAPYGQPYGYPPA-------PPPAQGYPATGYPP-AAYPPP------- 302 P P P G APQPA YGQPYG P+ PPP QGYP GY AYPPP Sbjct: 83 PMPPPAGY-APQPA-YGQPYGGYPSPPGQGYPPPPGQGYPPAGYSQGGAYPPPAQGYPHG 140 Query: 301 -GYPPSG 284 GYPP G Sbjct: 141 GGYPPPG 147 [30][TOP] >UniRef100_C0HFT3 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0HFT3_MAIZE Length = 357 Score = 62.4 bits (150), Expect = 2e-08 Identities = 42/80 (52%), Positives = 43/80 (53%), Gaps = 27/80 (33%) Frame = -1 Query: 442 YAPQPAPYGQP-APQPAPYGQPY------GYPPA--------PPPAQGYP-ATGYPP--- 320 YAPQPA YGQP P+P GQ Y GYPPA PPPAQGYP GYPP Sbjct: 208 YAPQPA-YGQPYGGYPSPPGQGYPPPPGQGYPPAGYSQGGAYPPPAQGYPHGGGYPPPGQ 266 Query: 319 -------AAYPPPG-YPPSG 284 AYPPPG YPP G Sbjct: 267 GYPQGQGGAYPPPGSYPPQG 286 Score = 57.4 bits (137), Expect = 5e-07 Identities = 35/67 (52%), Positives = 36/67 (53%), Gaps = 16/67 (23%) Frame = -1 Query: 436 PQPAPYGQPAPQPAPYGQPYGYPPA-------PPPAQGYPATGYPP-AAYPPP------- 302 P P P G APQPA YGQPYG P+ PPP QGYP GY AYPPP Sbjct: 201 PMPPPAGY-APQPA-YGQPYGGYPSPPGQGYPPPPGQGYPPAGYSQGGAYPPPAQGYPHG 258 Query: 301 -GYPPSG 284 GYPP G Sbjct: 259 GGYPPPG 265 [31][TOP] >UniRef100_A9NZ64 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NZ64_PICSI Length = 218 Score = 62.0 bits (149), Expect = 2e-08 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -1 Query: 382 PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 P GYPP+ P GYP +GYPPA YPP GYPPSGY Sbjct: 33 PSGYPPSGYPPSGYPPSGYPPAGYPPSGYPPSGY 66 Score = 61.6 bits (148), Expect = 3e-08 Identities = 28/49 (57%), Positives = 30/49 (61%), Gaps = 1/49 (2%) Frame = -1 Query: 424 PYGQPAPQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 P G P P G P GYPPA P GYP +GYPP+ YP GYPPSGY Sbjct: 33 PSGYPPSGYPPSGYPPSGYPPAGYPPSGYPPSGYPPSGYPSSGYPPSGY 81 Score = 60.5 bits (145), Expect = 6e-08 Identities = 26/49 (53%), Positives = 31/49 (63%) Frame = -1 Query: 430 PAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 284 P+ Y PA Y P GYPP+ P GYP++GYPP+ YPP GYPP G Sbjct: 43 PSGYPPSGYPPAGY-PPSGYPPSGYPPSGYPSSGYPPSGYPPAGYPPQG 90 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/49 (53%), Positives = 30/49 (61%), Gaps = 1/49 (2%) Frame = -1 Query: 424 PYGQPAPQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 P G P P G P GYPP+ P GYP +GYP + YPP GYPP+GY Sbjct: 38 PSGYPPSGYPPSGYPPAGYPPSGYPPSGYPPSGYPSSGYPPSGYPPAGY 86 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/32 (68%), Positives = 25/32 (78%) Frame = -1 Query: 376 GYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 GYPP+ P GYP +GYPP+ YPP GYPPSGY Sbjct: 30 GYPPSGYPPSGYPPSGYPPSGYPPAGYPPSGY 61 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/56 (48%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Frame = -1 Query: 442 YAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPP-GYPPSGYS 278 Y P P PA P P GYPP+ P+ GYP +GYPPA YPP GYPP ++ Sbjct: 46 YPPSGYP---PAGYPPSGYPPSGYPPSGYPSSGYPPSGYPPAGYPPQGGYPPPAHN 98 [32][TOP] >UniRef100_A9NRB0 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NRB0_PICSI Length = 208 Score = 62.0 bits (149), Expect = 2e-08 Identities = 26/38 (68%), Positives = 28/38 (73%), Gaps = 1/38 (2%) Frame = -1 Query: 391 YGQ-PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 +GQ P GYPP+ P GYP GYPPA YPP GYPPSGY Sbjct: 24 HGQSPSGYPPSGYPPSGYPPAGYPPAGYPPAGYPPSGY 61 Score = 60.1 bits (144), Expect = 7e-08 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = -1 Query: 382 PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 P GYPP+ P GYP GYPPA YPP GYPP+GY Sbjct: 33 PSGYPPSGYPPAGYPPAGYPPAGYPPSGYPPAGY 66 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/47 (55%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Frame = -1 Query: 421 YGQ-PAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 284 +GQ P+ P P GYPPA P GYP GYPP+ YPP GYPP G Sbjct: 24 HGQSPSGYPPSGYPPSGYPPAGYPPAGYPPAGYPPSGYPPAGYPPQG 70 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/48 (56%), Positives = 29/48 (60%), Gaps = 2/48 (4%) Frame = -1 Query: 427 APYGQPAPQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPP-GYPP 290 +P G P P G P GYPPA P GYP +GYPPA YPP GYPP Sbjct: 27 SPSGYPPSGYPPSGYPPAGYPPAGYPPAGYPPSGYPPAGYPPQGGYPP 74 [33][TOP] >UniRef100_B4DFJ6 cDNA FLJ53033, highly similar to Homo sapiens glutamate receptor, ionotropic, N-methyl D-asparate-associated protein 1, transcript variant 2, mRNA n=1 Tax=Homo sapiens RepID=B4DFJ6_HUMAN Length = 351 Score = 62.0 bits (149), Expect = 2e-08 Identities = 32/57 (56%), Positives = 34/57 (59%), Gaps = 3/57 (5%) Frame = -1 Query: 442 YAPQP-APYGQPAPQPAPYGQPYGYP--PAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 Y P P APY QP QP+PYGQP GYP P+P P GYP YP YP YP GY Sbjct: 14 YPPYPGAPYPQPPFQPSPYGQP-GYPHGPSPYPQGGYPQGPYPQGGYPQGPYPQEGY 69 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/55 (49%), Positives = 28/55 (50%), Gaps = 4/55 (7%) Frame = -1 Query: 433 QPAPYGQP----APQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 QP+PYGQP P P P G GYP P P GYP YP YP YP GY Sbjct: 28 QPSPYGQPGYPHGPSPYPQG---GYPQGPYPQGGYPQGPYPQEGYPQGPYPQGGY 79 [34][TOP] >UniRef100_UPI00006D2AFA PREDICTED: similar to glutamate receptor, ionotropic, N-methyl D-asparate-associated protein 1 isoform 3 n=1 Tax=Macaca mulatta RepID=UPI00006D2AFA Length = 371 Score = 61.6 bits (148), Expect = 3e-08 Identities = 33/59 (55%), Positives = 35/59 (59%), Gaps = 5/59 (8%) Frame = -1 Query: 442 YAPQP---APYGQPAPQPAPYGQPYGYP--PAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 YA P APY QP QP+PYGQP GYP P+P P GYP YP AYP YP GY Sbjct: 32 YAQPPYPGAPYPQPPFQPSPYGQP-GYPHGPSPYPQGGYPQGPYPQGAYPQGPYPQEGY 89 [35][TOP] >UniRef100_Q0D321 Rhodopsin (Fragment) n=1 Tax=Abraliopsis pacificus RepID=Q0D321_9MOLL Length = 299 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/45 (64%), Positives = 29/45 (64%), Gaps = 1/45 (2%) Frame = -1 Query: 415 QPAPQPAPYGQPYGYPPAP-PPAQGYPATGYPPAAYPPPGYPPSG 284 Q A QPA Y P GYPP PP QGYP GYPP YPP GYPP G Sbjct: 244 QQAQQPA-YPPPQGYPPQGYPPPQGYPPQGYPPQGYPPQGYPPQG 287 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/48 (52%), Positives = 26/48 (54%) Frame = -1 Query: 430 PAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPS 287 P P G P P Y P GYPP P QGYP GYPP PP G PP+ Sbjct: 252 PPPQGYP---PQGYPPPQGYPPQGYPPQGYPPQGYPPQGAPPQGAPPA 296 [36][TOP] >UniRef100_Q0D319 Rhodopsin (Fragment) n=1 Tax=Octopoteuthis nielseni RepID=Q0D319_9MOLL Length = 130 Score = 61.6 bits (148), Expect = 3e-08 Identities = 28/49 (57%), Positives = 28/49 (57%) Frame = -1 Query: 427 APYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 A Q PQ P P GYPP P QGYP GYPP YPP GYPP GY Sbjct: 77 AQQAQAPPQGYP---PQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGY 122 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/48 (58%), Positives = 28/48 (58%) Frame = -1 Query: 433 QPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPP 290 Q P G P PQ P P GYPP P QGYP GYPP YPP GYPP Sbjct: 81 QAPPQGYP-PQGYP---PQGYPPQGYPPQGYPPQGYPPQGYPPQGYPP 124 [37][TOP] >UniRef100_Q1DWE3 Putative uncharacterized protein n=1 Tax=Coccidioides immitis RepID=Q1DWE3_COCIM Length = 442 Score = 61.6 bits (148), Expect = 3e-08 Identities = 31/56 (55%), Positives = 32/56 (57%), Gaps = 3/56 (5%) Frame = -1 Query: 442 YAPQPAPYGQPAPQPAPYGQPYGYPPAP--PPAQGYPATGYPPAAYPPPG-YPPSG 284 Y P PA Y QP QP P+G PP PP QGYP GYPP YPP G YPP G Sbjct: 14 YNPNPA-YAQPGQQPPQQPPPHGAPPQGYYPPPQGYPPQGYPPQGYPPQGQYPPPG 68 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/49 (53%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = -1 Query: 418 GQPAPQPAP-YGQPYGYPPAPPPAQGYPATGY--PPAAYPPPGYPPSGY 281 G P P P Y QP PP PP G P GY PP YPP GYPP GY Sbjct: 10 GAPGYNPNPAYAQPGQQPPQQPPPHGAPPQGYYPPPQGYPPQGYPPQGY 58 [38][TOP] >UniRef100_C5PBW6 XYPPX repeat family protein n=1 Tax=Coccidioides posadasii C735 delta SOWgp RepID=C5PBW6_COCP7 Length = 442 Score = 61.6 bits (148), Expect = 3e-08 Identities = 31/56 (55%), Positives = 32/56 (57%), Gaps = 3/56 (5%) Frame = -1 Query: 442 YAPQPAPYGQPAPQPAPYGQPYGYPPAP--PPAQGYPATGYPPAAYPPPG-YPPSG 284 Y P PA Y QP QP P+G PP PP QGYP GYPP YPP G YPP G Sbjct: 14 YNPNPA-YAQPGQQPPQQPPPHGAPPQGYYPPPQGYPPQGYPPQGYPPQGQYPPPG 68 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/49 (53%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = -1 Query: 418 GQPAPQPAP-YGQPYGYPPAPPPAQGYPATGY--PPAAYPPPGYPPSGY 281 G P P P Y QP PP PP G P GY PP YPP GYPP GY Sbjct: 10 GAPGYNPNPAYAQPGQQPPQQPPPHGAPPQGYYPPPQGYPPQGYPPQGY 58 [39][TOP] >UniRef100_Q0D323 Rhodopsin (Fragment) n=1 Tax=Architeuthis sp. JMS-2004 RepID=Q0D323_9MOLL Length = 137 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/46 (63%), Positives = 29/46 (63%), Gaps = 2/46 (4%) Frame = -1 Query: 415 QPA-PQPAPYGQPYGYPPAP-PPAQGYPATGYPPAAYPPPGYPPSG 284 QPA P PA Y P GYPP PP QGYP GYPP YPP G PP G Sbjct: 82 QPAYPPPAGYPPPQGYPPQGYPPPQGYPPQGYPPQGYPPQGAPPQG 127 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/46 (60%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = -1 Query: 415 QPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPA-AYPPPGYPPSGY 281 Q A QPA Y P GYPP QGYP GYPP YPP GYPP GY Sbjct: 78 QQAQQPA-YPPPAGYPPP----QGYPPQGYPPPQGYPPQGYPPQGY 118 [40][TOP] >UniRef100_Q0D318 Rhodopsin (Fragment) n=1 Tax=Bathyteuthis abyssicola RepID=Q0D318_9MOLL Length = 170 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/46 (63%), Positives = 29/46 (63%), Gaps = 2/46 (4%) Frame = -1 Query: 415 QPAPQPAPYGQPYGYPPA--PPPAQGYPATGYPPAAYPPPGYPPSG 284 Q A QPA P GYPP PPP QGYP GYPP YPP GYPP G Sbjct: 111 QQAAQPAY--PPQGYPPQGYPPPPQGYPPQGYPPQGYPPQGYPPQG 154 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/46 (58%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = -1 Query: 415 QPAPQPAPYGQPYGYPPAPP--PAQGYPATGYPPAAYPPPGYPPSG 284 QPA P Y P GYPP P P QGYP GYPP YPP G PP G Sbjct: 115 QPAYPPQGY-PPQGYPPPPQGYPPQGYPPQGYPPQGYPPQGAPPQG 159 [41][TOP] >UniRef100_A0CRV7 Chromosome undetermined scaffold_25, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0CRV7_PARTE Length = 177 Score = 61.2 bits (147), Expect = 3e-08 Identities = 36/61 (59%), Positives = 36/61 (59%), Gaps = 10/61 (16%) Frame = -1 Query: 442 YAPQPAP-YGQPAPQPAPYGQP----YGYPPAP---PPAQGYPATGYPPA-AYPP-PGYP 293 Y P P P YGQP P P P QP Y YPP P PP GYP GYPPA YPP PGYP Sbjct: 16 YPPPPPPAYGQP-PYPQPGYQPPPTGYPYPPTPGYPPPVGGYPQPGYPPAPGYPPTPGYP 74 Query: 292 P 290 P Sbjct: 75 P 75 Score = 55.1 bits (131), Expect = 2e-06 Identities = 32/64 (50%), Positives = 33/64 (51%), Gaps = 12/64 (18%) Frame = -1 Query: 436 PQPAPYGQPA-----PQPAPYGQP-YGYPPAPPPAQGYP---ATGYPP--AAYPPPGYPP 290 P P PYG P P P YGQP Y P PP GYP GYPP YP PGYPP Sbjct: 4 PPPPPYGYPPAQYPPPPPPAYGQPPYPQPGYQPPPTGYPYPPTPGYPPPVGGYPQPGYPP 63 Query: 289 S-GY 281 + GY Sbjct: 64 APGY 67 [42][TOP] >UniRef100_A0C5H2 Chromosome undetermined scaffold_15, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0C5H2_PARTE Length = 198 Score = 61.2 bits (147), Expect = 3e-08 Identities = 37/73 (50%), Positives = 38/73 (52%), Gaps = 19/73 (26%) Frame = -1 Query: 442 YAPQPAP-YGQ-PAPQPAPYGQP------YGYPPA---PPPAQGYPATGYPPA-AYPP-- 305 Y P P P YGQ P PQ Y QP Y YPP PPP GYP GYPP YPP Sbjct: 17 YPPPPPPAYGQTPYPQQPGYQQPPPPPAGYPYPPTPGYPPPVGGYPQQGYPPTPGYPPTP 76 Query: 304 -----PGYPPSGY 281 PGYPP+GY Sbjct: 77 GYPPTPGYPPAGY 89 Score = 57.8 bits (138), Expect = 4e-07 Identities = 34/77 (44%), Positives = 34/77 (44%), Gaps = 25/77 (32%) Frame = -1 Query: 436 PQPAPYGQPAPQPAPYGQP--------------YGYPPAP--------PPAQGYPATGYP 323 PQ Y QP P PA Y P GYPP P PP GYP GYP Sbjct: 31 PQQPGYQQPPPPPAGYPYPPTPGYPPPVGGYPQQGYPPTPGYPPTPGYPPTPGYPPAGYP 90 Query: 322 PAAYPP--PGY-PPSGY 281 PA YPP PGY PP Y Sbjct: 91 PAGYPPPQPGYVPPPNY 107 Score = 53.5 bits (127), Expect = 7e-06 Identities = 33/66 (50%), Positives = 33/66 (50%), Gaps = 14/66 (21%) Frame = -1 Query: 436 PQPAPYG------QPAPQPAPYGQ-PY----GYPPAPPPAQGYPATGYPPA-AYPPP--G 299 P P PYG P P P YGQ PY GY PPP GYP YPP YPPP G Sbjct: 4 PPPPPYGGYPQGQYPPPPPPAYGQTPYPQQPGYQQPPPPPAGYP---YPPTPGYPPPVGG 60 Query: 298 YPPSGY 281 YP GY Sbjct: 61 YPQQGY 66 [43][TOP] >UniRef100_Q0D313 Rhodopsin (Fragment) n=1 Tax=Illex coindetii RepID=Q0D313_9MOLL Length = 286 Score = 60.8 bits (146), Expect = 4e-08 Identities = 29/51 (56%), Positives = 29/51 (56%) Frame = -1 Query: 433 QPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 Q A Y QP P P GYPP P QGYP GYPP YPP GYPP GY Sbjct: 225 QQAAYPQPPP-------PQGYPPPP---QGYPPQGYPPQGYPPQGYPPQGY 265 [44][TOP] >UniRef100_Q3BDP1 Rhodopsin (Fragment) n=1 Tax=Sepioteuthis lessoniana RepID=Q3BDP1_SEPLE Length = 288 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/45 (62%), Positives = 28/45 (62%) Frame = -1 Query: 415 QPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 Q Q A Y P GYPP PP QGYP GYPP YPP GYPP GY Sbjct: 243 QQQQQQAAY-PPQGYPPPPP--QGYPPQGYPPQGYPPQGYPPQGY 284 [45][TOP] >UniRef100_B4YS99 Rhodopsin (Fragment) n=1 Tax=Afrololigo mercatoris RepID=B4YS99_9MOLL Length = 303 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/46 (60%), Positives = 29/46 (63%), Gaps = 3/46 (6%) Frame = -1 Query: 415 QPAPQPAPYGQPYGYPPA---PPPAQGYPATGYPPAAYPPPGYPPS 287 Q QPA Y P GYPP PPP QGYP GYPP YPP GYPP+ Sbjct: 243 QQQQQPA-YPPPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPPA 287 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/47 (57%), Positives = 27/47 (57%) Frame = -1 Query: 430 PAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPP 290 P P G P PQ P P GYPP P QGYP GYPPA PPP PP Sbjct: 251 PPPQGYP-PQGYPPPPPQGYPPQGYPPQGYPPQGYPPAQGPPPQGPP 296 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/48 (56%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = -1 Query: 415 QPAPQPAPYGQPYGYPPAPP---PAQGYPATGYPPAAYPPP-GYPPSG 284 QPA P P GYPP PP P QGYP GYPP YPP G PP G Sbjct: 247 QPAYPPPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPPAQGPPPQG 294 [46][TOP] >UniRef100_UPI00015611AB PREDICTED: similar to glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1 n=1 Tax=Equus caballus RepID=UPI00015611AB Length = 366 Score = 60.1 bits (144), Expect = 7e-08 Identities = 34/68 (50%), Positives = 37/68 (54%), Gaps = 14/68 (20%) Frame = -1 Query: 436 PQPA-------PYGQPAPQPAPYGQPYGYPPAPPP------AQG-YPATGYPPAAYPPPG 299 PQP+ PY QP QP+PYGQP GYP P P QG YP GYP YP G Sbjct: 25 PQPSMPPYPGVPYPQPPFQPSPYGQP-GYPQGPSPYPQGGYPQGPYPQGGYPQGPYPQGG 83 Query: 298 YPPSGYSR 275 YPP YS+ Sbjct: 84 YPPDPYSQ 91 Score = 56.6 bits (135), Expect = 8e-07 Identities = 29/53 (54%), Positives = 31/53 (58%), Gaps = 2/53 (3%) Frame = -1 Query: 433 QPAPYGQPA-PQ-PAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 QP+PYGQP PQ P+PY Q GYP P P GYP YP YPP Y GY Sbjct: 43 QPSPYGQPGYPQGPSPYPQG-GYPQGPYPQGGYPQGPYPQGGYPPDPYSQGGY 94 [47][TOP] >UniRef100_Q6QE83 Rhodopsin (Fragment) n=1 Tax=Sthenoteuthis oualaniensis RepID=Q6QE83_9MOLL Length = 295 Score = 60.1 bits (144), Expect = 7e-08 Identities = 29/53 (54%), Positives = 31/53 (58%), Gaps = 2/53 (3%) Frame = -1 Query: 433 QPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPP--GYPPSGY 281 Q A Y P P P Y P GYPP P QGYP GYPP YPPP G PP+G+ Sbjct: 232 QQAAY--PPPPPQGYPPPQGYPPQGYPPQGYPPQGYPPQGYPPPPQGPPPAGW 282 [48][TOP] >UniRef100_Q0D025 Putative uncharacterized protein n=1 Tax=Aspergillus terreus NIH2624 RepID=Q0D025_ASPTN Length = 548 Score = 60.1 bits (144), Expect = 7e-08 Identities = 29/56 (51%), Positives = 31/56 (55%), Gaps = 5/56 (8%) Frame = -1 Query: 439 APQPAPYGQPAPQPAPYGQPYGYPP-----APPPAQGYPATGYPPAAYPPPGYPPS 287 AP P P P +P+P P GYPP APPP QGYP PP PPPG PPS Sbjct: 52 APSPQPQAYPGARPSPSPAPQGYPPSPYSQAPPPPQGYPQA--PPYGQPPPGPPPS 105 [49][TOP] >UniRef100_Q7Z429 Glutamate [NMDA] receptor-associated protein 1 n=1 Tax=Homo sapiens RepID=GRINA_HUMAN Length = 371 Score = 60.1 bits (144), Expect = 7e-08 Identities = 32/59 (54%), Positives = 34/59 (57%), Gaps = 5/59 (8%) Frame = -1 Query: 442 YAPQP---APYGQPAPQPAPYGQPYGYP--PAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 YA P APY QP QP+PYGQP GYP P+P P GYP YP YP YP GY Sbjct: 32 YAQPPYPGAPYPQPPFQPSPYGQP-GYPHGPSPYPQGGYPQGPYPQGGYPQGPYPQEGY 89 [50][TOP] >UniRef100_A9P8I3 Predicted protein n=1 Tax=Populus trichocarpa RepID=A9P8I3_POPTR Length = 125 Score = 59.7 bits (143), Expect = 1e-07 Identities = 31/55 (56%), Positives = 33/55 (60%), Gaps = 3/55 (5%) Frame = -1 Query: 433 QPAPYGQPAPQPAPYGQPY---GYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYS 278 Q AP+ QP P P+ Y PY GYPP PP GYP T P YPPPG PP GYS Sbjct: 4 QKAPH-QPYP-PSGYSPPYPPPGYPPTTPPYGGYPPTTPPYGGYPPPGAPPPGYS 56 [51][TOP] >UniRef100_A8J6J7 Predicted protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8J6J7_CHLRE Length = 539 Score = 59.7 bits (143), Expect = 1e-07 Identities = 34/67 (50%), Positives = 35/67 (52%), Gaps = 16/67 (23%) Frame = -1 Query: 436 PQPAPYGQPAPQPAPYG-----QPYGYPP-----APPPAQG------YPATGYPPAAYPP 305 PQ PYG P PQ PYG QPYG PP APPPA G P G+P PP Sbjct: 403 PQQQPYGAP-PQQQPYGAPPQQQPYGAPPQQPYGAPPPAYGAPVGYAQPPAGHPAYGAPP 461 Query: 304 PGYPPSG 284 PGYPP G Sbjct: 462 PGYPPYG 468 Score = 53.9 bits (128), Expect = 5e-06 Identities = 32/61 (52%), Positives = 33/61 (54%), Gaps = 9/61 (14%) Frame = -1 Query: 436 PQPAPYGQPAPQP--AP---YGQPYGY--PPAPPPAQGYPATGYPPAAYPP--PGYPPSG 284 PQ PYG P QP AP YG P GY PPA PA G P GYPP PP GY P+ Sbjct: 421 PQQQPYGAPPQQPYGAPPPAYGAPVGYAQPPAGHPAYGAPPPGYPPYGPPPGAQGYTPAH 480 Query: 283 Y 281 Y Sbjct: 481 Y 481 [52][TOP] >UniRef100_Q3BDP2 Rhodopsin (Fragment) n=1 Tax=Sepioteuthis australis RepID=Q3BDP2_9MOLL Length = 294 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/41 (65%), Positives = 27/41 (65%) Frame = -1 Query: 403 QPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 Q A Y P GYPP PP QGYP GYPP YPP GYPP GY Sbjct: 246 QQAAY-PPQGYPPPPP--QGYPPQGYPPQGYPPQGYPPQGY 283 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/42 (59%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = -1 Query: 406 PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPP-GYPPSG 284 PQ P P GYPP P QGYP GYPP YPPP G PP G Sbjct: 252 PQGYPPPPPQGYPPQGYPPQGYPPQGYPPQGYPPPQGPPPQG 293 [53][TOP] >UniRef100_UPI0001984D5A PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001984D5A Length = 300 Score = 59.3 bits (142), Expect = 1e-07 Identities = 29/52 (55%), Positives = 30/52 (57%), Gaps = 1/52 (1%) Frame = -1 Query: 433 QPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGY-PPAAYPPPGYPPSGY 281 QP P P YGQP+GYPP P Q YPA GY PP AYPP YPP Y Sbjct: 200 QPIPPLVGHPSEPSYGQPHGYPP-PGQVQDYPAAGYPPPQAYPPHAYPPQAY 250 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/62 (41%), Positives = 27/62 (43%), Gaps = 10/62 (16%) Frame = -1 Query: 436 PQPAPYGQPAPQPAP----------YGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPS 287 P YGQP P P Y P YPP P Q YP YPP AYPP +PP Sbjct: 209 PSEPSYGQPHGYPPPGQVQDYPAAGYPPPQAYPPHAYPPQAYPPQAYPPQAYPPQAHPPQ 268 Query: 286 GY 281 Y Sbjct: 269 AY 270 [54][TOP] >UniRef100_Q84TC1 Putative uncharacterized protein OJ1754_E06.10 n=1 Tax=Oryza sativa Japonica Group RepID=Q84TC1_ORYSJ Length = 185 Score = 59.3 bits (142), Expect = 1e-07 Identities = 29/58 (50%), Positives = 32/58 (55%), Gaps = 8/58 (13%) Frame = -1 Query: 430 PAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPAT--GYPPAAYPP------PGYPPSGY 281 P P G P+ P Y GYP A P GYP + GYPP AYPP PGYPP+GY Sbjct: 43 PTPGGYPSAPPGQYPPAGGYPGAQYPPSGYPPSQGGYPPGAYPPSGYPQQPGYPPAGY 100 Score = 54.3 bits (129), Expect = 4e-06 Identities = 31/61 (50%), Positives = 32/61 (52%), Gaps = 11/61 (18%) Frame = -1 Query: 430 PAPYGQPAPQPAPYGQPYGYPPAPP----PAQGYPATGYPPAAYP------PPG-YPPSG 284 P G P P Y P GYP APP PA GYP YPP+ YP PPG YPPSG Sbjct: 30 PLMQGYPN-SPGQYPTPGGYPSAPPGQYPPAGGYPGAQYPPSGYPPSQGGYPPGAYPPSG 88 Query: 283 Y 281 Y Sbjct: 89 Y 89 [55][TOP] >UniRef100_Q10BG2 Os03g0819300 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q10BG2_ORYSJ Length = 180 Score = 59.3 bits (142), Expect = 1e-07 Identities = 29/58 (50%), Positives = 32/58 (55%), Gaps = 8/58 (13%) Frame = -1 Query: 430 PAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPAT--GYPPAAYPP------PGYPPSGY 281 P P G P+ P Y GYP A P GYP + GYPP AYPP PGYPP+GY Sbjct: 43 PTPGGYPSAPPGQYPPAGGYPGAQYPPSGYPPSQGGYPPGAYPPSGYPQQPGYPPAGY 100 Score = 54.3 bits (129), Expect = 4e-06 Identities = 31/61 (50%), Positives = 32/61 (52%), Gaps = 11/61 (18%) Frame = -1 Query: 430 PAPYGQPAPQPAPYGQPYGYPPAPP----PAQGYPATGYPPAAYP------PPG-YPPSG 284 P G P P Y P GYP APP PA GYP YPP+ YP PPG YPPSG Sbjct: 30 PLMQGYPN-SPGQYPTPGGYPSAPPGQYPPAGGYPGAQYPPSGYPPSQGGYPPGAYPPSG 88 Query: 283 Y 281 Y Sbjct: 89 Y 89 [56][TOP] >UniRef100_B9SDA8 Glycine-rich protein A3, putative n=1 Tax=Ricinus communis RepID=B9SDA8_RICCO Length = 177 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/60 (50%), Positives = 35/60 (58%), Gaps = 4/60 (6%) Frame = -1 Query: 442 YAPQPAPYGQPAPQPAPYGQ---PYGYPPAPPPAQGYPATGYP-PAAYPPPGYPPSGYSR 275 Y PQ P PA P+PYG P YPP+ PP + Y TG+P P YPP YPP+GY R Sbjct: 47 YPPQGFP---PAGYPSPYGYSSPPSAYPPSYPPQKPYGPTGFPSPGGYPPVAYPPAGYPR 103 [57][TOP] >UniRef100_A7PZM5 Chromosome chr15 scaffold_40, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7PZM5_VITVI Length = 276 Score = 59.3 bits (142), Expect = 1e-07 Identities = 29/52 (55%), Positives = 30/52 (57%), Gaps = 1/52 (1%) Frame = -1 Query: 433 QPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGY-PPAAYPPPGYPPSGY 281 QP P P YGQP+GYPP P Q YPA GY PP AYPP YPP Y Sbjct: 176 QPIPPLVGHPSEPSYGQPHGYPP-PGQVQDYPAAGYPPPQAYPPHAYPPQAY 226 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/62 (41%), Positives = 27/62 (43%), Gaps = 10/62 (16%) Frame = -1 Query: 436 PQPAPYGQPAPQPAP----------YGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPS 287 P YGQP P P Y P YPP P Q YP YPP AYPP +PP Sbjct: 185 PSEPSYGQPHGYPPPGQVQDYPAAGYPPPQAYPPHAYPPQAYPPQAYPPQAYPPQAHPPQ 244 Query: 286 GY 281 Y Sbjct: 245 AY 246 [58][TOP] >UniRef100_Q0D324 Rhodopsin (Fragment) n=1 Tax=Onychoteuthis sp. B3-JMS-2004 RepID=Q0D324_9MOLL Length = 303 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/48 (56%), Positives = 27/48 (56%) Frame = -1 Query: 427 APYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 284 A Q A P P P GYPP P QGYP GYPP YPP GYPP G Sbjct: 243 AQQAQQAAYPPP---PQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQG 287 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/45 (57%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -1 Query: 415 QPAPQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 284 Q A P P G P GYPP P QGYP GYPP YPP G PP G Sbjct: 248 QAAYPPPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGAPPQG 292 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -1 Query: 361 PPPAQGYPATGYPPAAYPPPGYPPSGY 281 PPP QGYP GYPP YPP GYPP GY Sbjct: 252 PPPPQGYPPQGYPPQGYPPQGYPPQGY 278 [59][TOP] >UniRef100_Q3BDP7 Rhodopsin (Fragment) n=1 Tax=Bathyteuthis berryi RepID=Q3BDP7_9MOLL Length = 267 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/44 (63%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = -1 Query: 415 QPAPQPAPYGQPYGYPPA--PPPAQGYPATGYPPAAYPPPGYPP 290 Q A QPA P GYPP PPP QGYP GYPP YPP GYPP Sbjct: 226 QQAAQPAY--PPQGYPPQGYPPPPQGYPPQGYPPQGYPPQGYPP 267 [60][TOP] >UniRef100_Q3BDN9 Rhodopsin (Fragment) n=1 Tax=Loliolus sp. JMS-2004 RepID=Q3BDN9_9MOLL Length = 297 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 3/43 (6%) Frame = -1 Query: 403 QPAPYGQPYGYPPA---PPPAQGYPATGYPPAAYPPPGYPPSG 284 Q A Y P GYPP PPP QGYP GYPP YPP GYPP G Sbjct: 246 QQAAY-PPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPPQG 287 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/47 (55%), Positives = 26/47 (55%), Gaps = 3/47 (6%) Frame = -1 Query: 415 QPAPQPAPYGQPYGYPPAPP---PAQGYPATGYPPAAYPPPGYPPSG 284 Q A P P GYPP PP P QGYP GYPP YPP G PP G Sbjct: 246 QQAAYPPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPPQGAPPQG 292 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/45 (55%), Positives = 25/45 (55%) Frame = -1 Query: 424 PYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPP 290 P G P PQ P P GYPP P QGYP GYPP PP G PP Sbjct: 252 PQGYP-PQGYPPPPPQGYPPQGYPPQGYPPQGYPPQGAPPQGAPP 295 [61][TOP] >UniRef100_Q0D314 Rhodopsin (Fragment) n=1 Tax=Cranchia scabra RepID=Q0D314_9MOLL Length = 278 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -1 Query: 382 PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 P GYPP P QGYP GYPP YPP GYPP GY Sbjct: 238 PAGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGY 271 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -1 Query: 415 QPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 284 Q PA Y P GYPP P QGYP GYPP YPP GYPP G Sbjct: 233 QAQAPPAGY-PPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQG 275 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/48 (56%), Positives = 27/48 (56%) Frame = -1 Query: 433 QPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPP 290 Q P G P PQ P P GYPP P QGYP GYPP YPP G PP Sbjct: 235 QAPPAGYP-PQGYP---PQGYPPQGYPPQGYPPQGYPPQGYPPQGAPP 278 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -1 Query: 370 PPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 PPA P QGYP GYPP YPP GYPP GY Sbjct: 237 PPAGYPPQGYPPQGYPPQGYPPQGYPPQGY 266 [62][TOP] >UniRef100_B8AMB4 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8AMB4_ORYSI Length = 180 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/58 (50%), Positives = 32/58 (55%), Gaps = 8/58 (13%) Frame = -1 Query: 430 PAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPAT--GYPPAAYPP------PGYPPSGY 281 P P G P+ P Y GYP A P GYP + GYPP AYPP PGYPP+GY Sbjct: 43 PTPGGYPSAPPGQYPPAGGYPGAQYPPGGYPPSQGGYPPGAYPPSGYPQQPGYPPAGY 100 Score = 53.9 bits (128), Expect = 5e-06 Identities = 31/61 (50%), Positives = 31/61 (50%), Gaps = 11/61 (18%) Frame = -1 Query: 430 PAPYGQPAPQPAPYGQPYGYPPAPP----PAQGYPATGYPPAAYP------PPG-YPPSG 284 P G P P Y P GYP APP PA GYP YPP YP PPG YPPSG Sbjct: 30 PLMQGYPN-SPGQYPTPGGYPSAPPGQYPPAGGYPGAQYPPGGYPPSQGGYPPGAYPPSG 88 Query: 283 Y 281 Y Sbjct: 89 Y 89 [63][TOP] >UniRef100_A2XNE8 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2XNE8_ORYSI Length = 185 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/58 (50%), Positives = 32/58 (55%), Gaps = 8/58 (13%) Frame = -1 Query: 430 PAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPAT--GYPPAAYPP------PGYPPSGY 281 P P G P+ P Y GYP A P GYP + GYPP AYPP PGYPP+GY Sbjct: 43 PTPGGYPSAPPGQYPPADGYPGAQYPPGGYPPSQGGYPPGAYPPSGYPQQPGYPPAGY 100 Score = 54.7 bits (130), Expect = 3e-06 Identities = 31/61 (50%), Positives = 31/61 (50%), Gaps = 11/61 (18%) Frame = -1 Query: 430 PAPYGQPAPQPAPYGQPYGYPPAPP----PAQGYPATGYPPAAYP------PPG-YPPSG 284 P G P P Y P GYP APP PA GYP YPP YP PPG YPPSG Sbjct: 30 PLMQGYPN-SPGQYPTPGGYPSAPPGQYPPADGYPGAQYPPGGYPPSQGGYPPGAYPPSG 88 Query: 283 Y 281 Y Sbjct: 89 Y 89 [64][TOP] >UniRef100_Q6QE84 Rhodopsin (Fragment) n=1 Tax=Loligo forbesi RepID=Q6QE84_LOLFO Length = 305 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/45 (57%), Positives = 26/45 (57%), Gaps = 3/45 (6%) Frame = -1 Query: 415 QPAPQPAPYGQPYGYPPA---PPPAQGYPATGYPPAAYPPPGYPP 290 Q Q P P GYPP PPP QGYP GYPP YPP GYPP Sbjct: 241 QAQQQQQPAYPPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPP 285 [65][TOP] >UniRef100_Q3BDP0 Rhodopsin (Fragment) n=1 Tax=Photololigo sp. JMS-2004 RepID=Q3BDP0_9MOLL Length = 305 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/45 (57%), Positives = 26/45 (57%), Gaps = 3/45 (6%) Frame = -1 Query: 415 QPAPQPAPYGQPYGYPPA---PPPAQGYPATGYPPAAYPPPGYPP 290 Q Q P P GYPP PPP QGYP GYPP YPP GYPP Sbjct: 241 QAQQQQQPAYPPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPP 285 [66][TOP] >UniRef100_Q3BDN7 Rhodopsin (Fragment) n=1 Tax=Heteroteuthis hawaiiensis RepID=Q3BDN7_9MOLL Length = 294 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/47 (63%), Positives = 30/47 (63%), Gaps = 3/47 (6%) Frame = -1 Query: 415 QPAPQPAPYGQPYGYPPA--PPPAQGYPATGYPP-AAYPPPGYPPSG 284 Q A QPA P GYPP PPP QGYP GYPP AYPP GYPP G Sbjct: 234 QQAQQPAY--PPQGYPPQGYPPPPQGYPPQGYPPQGAYPPQGYPPQG 278 [67][TOP] >UniRef100_A7S7Y1 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7S7Y1_NEMVE Length = 349 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/63 (47%), Positives = 30/63 (47%), Gaps = 11/63 (17%) Frame = -1 Query: 436 PQPAPYGQPAPQPAP--YGQPYGYPPAPPPAQGYPATGY---------PPAAYPPPGYPP 290 P P G P P P Y P GYPP P Q YPA Y PP AYP PGYPP Sbjct: 150 PYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQPPPQAYPQPGYPP 209 Query: 289 SGY 281 GY Sbjct: 210 QGY 212 Score = 55.1 bits (131), Expect = 2e-06 Identities = 31/60 (51%), Positives = 34/60 (56%), Gaps = 7/60 (11%) Frame = -1 Query: 436 PQPAPYGQPAPQPAPY-GQPY---GYPPAPPPAQGYPATGYPPAAYPPPG-YPPS--GYS 278 P P Y + P PY QPY GYPP PPP Q YP GYPP YPP G YP + GY+ Sbjct: 168 PPPGGYPPTSYPPQPYPAQPYPQQGYPPQPPP-QAYPQPGYPPQGYPPTGPYPQTQPGYA 226 [68][TOP] >UniRef100_C8VNA3 Annexin, putative (Eurofung) n=2 Tax=Emericella nidulans RepID=C8VNA3_EMENI Length = 501 Score = 58.5 bits (140), Expect = 2e-07 Identities = 33/63 (52%), Positives = 33/63 (52%), Gaps = 13/63 (20%) Frame = -1 Query: 439 APQPAPYGQPAPQPAPYGQ------------PYGYPPAPPPAQGYPATGYPPAA-YPPPG 299 A PAPY QP P YGQ PYG PP PP A YP YPPAA YPP G Sbjct: 94 AQPPAPYQQPPSGPGSYGQANPPYGSAPPPNPYGTPP-PPHAAPYPPGQYPPAAGYPPQG 152 Query: 298 YPP 290 YPP Sbjct: 153 YPP 155 [69][TOP] >UniRef100_Q17094 Rhodopsin (Fragment) n=1 Tax=Alloteuthis subulata RepID=OPSD_LOLSU Length = 439 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/45 (57%), Positives = 26/45 (57%), Gaps = 3/45 (6%) Frame = -1 Query: 415 QPAPQPAPYGQPYGYPPA---PPPAQGYPATGYPPAAYPPPGYPP 290 Q Q P P GYPP PPP QGYP GYPP YPP GYPP Sbjct: 374 QAQQQQQPAYPPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPP 418 [70][TOP] >UniRef100_P24603 Rhodopsin n=1 Tax=Loligo forbesi RepID=OPSD_LOLFO Length = 452 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/45 (57%), Positives = 26/45 (57%), Gaps = 3/45 (6%) Frame = -1 Query: 415 QPAPQPAPYGQPYGYPPA---PPPAQGYPATGYPPAAYPPPGYPP 290 Q Q P P GYPP PPP QGYP GYPP YPP GYPP Sbjct: 381 QAQQQQQPAYPPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPP 425 [71][TOP] >UniRef100_UPI0001B5174A hypothetical protein SgriT_24334 n=1 Tax=Streptomyces griseoflavus Tu4000 RepID=UPI0001B5174A Length = 323 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/53 (54%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = -1 Query: 433 QPAPYGQPAPQPAPYGQ--PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 QP PYG QP PYGQ PYG P P G P GYP A PPPG P GY Sbjct: 5 QPGPYGGQPQQPGPYGQPGPYGQQPQAPQPGGQPGYGYPQQA-PPPGQPGYGY 56 Score = 57.4 bits (137), Expect = 5e-07 Identities = 32/53 (60%), Positives = 32/53 (60%), Gaps = 2/53 (3%) Frame = -1 Query: 433 QPAPYGQPAPQPAPYGQP-YGYP-PAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 QP PYGQ P P GQP YGYP APPP G P GYP A PPPG P GY Sbjct: 21 QPGPYGQQPQAPQPGGQPGYGYPQQAPPP--GQPGYGYPQQA-PPPGQPGYGY 70 [72][TOP] >UniRef100_UPI0000E21CE9 PREDICTED: similar to Glutamate receptor, ionotropic, N-methyl D-asparate-associated protein 1 (glutamate binding) isoform 1 n=1 Tax=Pan troglodytes RepID=UPI0000E21CE9 Length = 304 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/57 (54%), Positives = 32/57 (56%), Gaps = 3/57 (5%) Frame = -1 Query: 442 YAPQP---APYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 YA P APY QP QP+PYGQP GYP P P YP GYP YP GYP Y Sbjct: 32 YAQPPYPGAPYPQPPFQPSPYGQP-GYPHGPSP---YPQGGYPQGPYPQGGYPQGPY 84 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/55 (49%), Positives = 28/55 (50%), Gaps = 4/55 (7%) Frame = -1 Query: 433 QPAPYGQP----APQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 QP+PYGQP P P P G GYP P P GYP YP YP YP GY Sbjct: 48 QPSPYGQPGYPHGPSPYPQG---GYPQGPYPQGGYPQGPYPQEVYPQGPYPQGGY 99 [73][TOP] >UniRef100_UPI0000E21CE8 PREDICTED: similar to Glutamate receptor, ionotropic, N-methyl D-asparate-associated protein 1 (glutamate binding) isoform 2 n=1 Tax=Pan troglodytes RepID=UPI0000E21CE8 Length = 328 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/57 (54%), Positives = 32/57 (56%), Gaps = 3/57 (5%) Frame = -1 Query: 442 YAPQP---APYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 YA P APY QP QP+PYGQP GYP P P YP GYP YP GYP Y Sbjct: 32 YAQPPYPGAPYPQPPFQPSPYGQP-GYPHGPSP---YPQGGYPQGPYPQGGYPQGPY 84 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/55 (49%), Positives = 28/55 (50%), Gaps = 4/55 (7%) Frame = -1 Query: 433 QPAPYGQP----APQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 QP+PYGQP P P P G GYP P P GYP YP YP YP GY Sbjct: 48 QPSPYGQPGYPHGPSPYPQG---GYPQGPYPQGGYPQGPYPQEVYPQGPYPQGGY 99 [74][TOP] >UniRef100_UPI0000E21CE7 PREDICTED: similar to Glutamate receptor, ionotropic, N-methyl D-asparate-associated protein 1 (glutamate binding) isoform 4 n=1 Tax=Pan troglodytes RepID=UPI0000E21CE7 Length = 371 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/57 (54%), Positives = 32/57 (56%), Gaps = 3/57 (5%) Frame = -1 Query: 442 YAPQP---APYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 YA P APY QP QP+PYGQP GYP P P YP GYP YP GYP Y Sbjct: 32 YAQPPYPGAPYPQPPFQPSPYGQP-GYPHGPSP---YPQGGYPQGPYPQGGYPQGPY 84 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/55 (49%), Positives = 28/55 (50%), Gaps = 4/55 (7%) Frame = -1 Query: 433 QPAPYGQP----APQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 QP+PYGQP P P P G GYP P P GYP YP YP YP GY Sbjct: 48 QPSPYGQPGYPHGPSPYPQG---GYPQGPYPQGGYPQGPYPQEVYPQGPYPQGGY 99 [75][TOP] >UniRef100_UPI0000E21CE6 PREDICTED: similar to Glutamate receptor, ionotropic, N-methyl D-asparate-associated protein 1 (glutamate binding) isoform 3 n=1 Tax=Pan troglodytes RepID=UPI0000E21CE6 Length = 352 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/57 (54%), Positives = 32/57 (56%), Gaps = 3/57 (5%) Frame = -1 Query: 442 YAPQP---APYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 YA P APY QP QP+PYGQP GYP P P YP GYP YP GYP Y Sbjct: 32 YAQPPYPGAPYPQPPFQPSPYGQP-GYPHGPSP---YPQGGYPQGPYPQGGYPQGPY 84 [76][TOP] >UniRef100_A7PSK5 Chromosome chr6 scaffold_28, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7PSK5_VITVI Length = 191 Score = 58.2 bits (139), Expect = 3e-07 Identities = 32/58 (55%), Positives = 34/58 (58%), Gaps = 8/58 (13%) Frame = -1 Query: 430 PAPYGQPAPQPAPYGQPYGYPPAP-PPAQGYPATGYPP------AAYPPP-GYPPSGY 281 P P G P P+ Y P GYPP+ PP GYP GYPP A YPPP GYPPSGY Sbjct: 47 PPPGGYP---PSGYPPPGGYPPSGYPPPGGYPPAGYPPPGGYPPAPYPPPGGYPPSGY 101 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/55 (47%), Positives = 30/55 (54%), Gaps = 1/55 (1%) Frame = -1 Query: 442 YAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPP-GYPPSGY 281 Y P Y P+ Y P GYPP+ P G GYPP+ YPPP GYPP+GY Sbjct: 29 YRPPHGAYHSQGYPPSAYPPPGGYPPSGYPPPG----GYPPSGYPPPGGYPPAGY 79 [77][TOP] >UniRef100_A1SHX4 TM2 domain containing protein+B7201 n=1 Tax=Nocardioides sp. JS614 RepID=A1SHX4_NOCSJ Length = 155 Score = 57.8 bits (138), Expect = 4e-07 Identities = 37/80 (46%), Positives = 41/80 (51%), Gaps = 9/80 (11%) Frame = -1 Query: 439 APQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPP---------AAYPPPGYPPS 287 AP P PYG AP P PYGQP GYP PPPA GYP TG P +P G P S Sbjct: 29 APAPPPYG--APAPPPYGQPSGYP--PPPAGGYPPTGAAPYGASPAAPYGVHPVTGIPYS 84 Query: 286 GYSR*FI*HMLCVGLLRQLI 227 ++ L GLL+ LI Sbjct: 85 DKTK------LVAGLLQILI 98 [78][TOP] >UniRef100_C1WS34 Predicted metal-dependent membrane protease n=1 Tax=Kribbella flavida DSM 17836 RepID=C1WS34_9ACTO Length = 432 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/54 (53%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = -1 Query: 442 YAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAY-PPPGYPPSG 284 +A Q PYGQP PAPYGQ YG PP PP Y P Y PPPG PP G Sbjct: 45 WAGQQPPYGQPPNAPAPYGQQYGQPPQGPP--------YGPGPYGPPPGQPPYG 90 [79][TOP] >UniRef100_B6SHN0 Adhesive/proline-rich protein n=1 Tax=Zea mays RepID=B6SHN0_MAIZE Length = 93 Score = 57.8 bits (138), Expect = 4e-07 Identities = 31/56 (55%), Positives = 31/56 (55%), Gaps = 5/56 (8%) Frame = -1 Query: 442 YAPQPAPYGQPAPQPAPYGQPY---GYPPA--PPPAQGYPATGYPPAAYPPPGYPP 290 Y QP P G P Q P Y GYPPA PPPAQGYP GYP YP GYPP Sbjct: 4 YGQQP-PVGVPPQQGYPGKDGYPPAGYPPAGYPPPAQGYPPQGYPQQGYPQQGYPP 58 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/53 (52%), Positives = 28/53 (52%), Gaps = 6/53 (11%) Frame = -1 Query: 421 YGQPAPQPAPYGQPY----GYPPAPPPAQGYP--ATGYPPAAYPPPGYPPSGY 281 YGQ P P Q Y GYPPA P GYP A GYPP YP GYP GY Sbjct: 4 YGQQPPVGVPPQQGYPGKDGYPPAGYPPAGYPPPAQGYPPQGYPQQGYPQQGY 56 [80][TOP] >UniRef100_Q3BDP4 Rhodopsin (Fragment) n=1 Tax=Ommastrephes bartramii RepID=Q3BDP4_9MOLL Length = 296 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/52 (55%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = -1 Query: 433 QPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPP--GYPPSG 284 Q A Y P PQ P P GYPP P QGYP GYPP YPPP G PP G Sbjct: 237 QQAAYPPPPPQGYP---PQGYPPQGYPPQGYPPQGYPPQGYPPPPQGPPPQG 285 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/38 (63%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Frame = -1 Query: 385 QPYGYPPAPP---PAQGYPATGYPPAAYPPPGYPPSGY 281 Q YPP PP P QGYP GYPP YPP GYPP GY Sbjct: 237 QQAAYPPPPPQGYPPQGYPPQGYPPQGYPPQGYPPQGY 274 [81][TOP] >UniRef100_Q0D322 Rhodopsin (Fragment) n=1 Tax=Histioteuthis oceanica RepID=Q0D322_9MOLL Length = 299 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/56 (51%), Positives = 29/56 (51%), Gaps = 4/56 (7%) Frame = -1 Query: 439 APQPAPYGQPAPQPAPYG--QPYGYPPA--PPPAQGYPATGYPPAAYPPPGYPPSG 284 A A Q A P P P GYPP PPP QGYP GYPP YPP G PP G Sbjct: 233 AKMQAQQAQQAAYPPPQQGYPPQGYPPQGYPPPPQGYPPQGYPPQGYPPQGAPPQG 288 [82][TOP] >UniRef100_A9VE52 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9VE52_MONBE Length = 458 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/60 (43%), Positives = 28/60 (46%), Gaps = 6/60 (10%) Frame = -1 Query: 442 YAPQPAPYGQPA------PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 Y PQ PY P PQ PY P YPP P+Q + YPP AYPP YP Y Sbjct: 373 YPPQAYPYNPPQTHPHDPPQAYPYNPPQAYPPQAHPSQAHSPQAYPPQAYPPQAYPSQAY 432 [83][TOP] >UniRef100_Q6QE96 Rhodopsin (Fragment) n=1 Tax=Octopus bimaculoides RepID=Q6QE96_OCTBM Length = 294 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/52 (57%), Positives = 30/52 (57%), Gaps = 2/52 (3%) Frame = -1 Query: 433 QPAPYGQPAPQPAPYGQPYGYPPAPP-PAQGYPATG-YPPAAYPPPGYPPSG 284 Q A Y QP PQ P P GYPP P QGYP G YPP YPP GYPP G Sbjct: 243 QQAAYQQPPPQGYP---PQGYPPQGAYPPQGYPPQGAYPPQGYPPQGYPPQG 291 [84][TOP] >UniRef100_Q3BDP3 Rhodopsin (Fragment) n=1 Tax=Lolliguncula brevis RepID=Q3BDP3_9MOLL Length = 296 Score = 57.4 bits (137), Expect = 5e-07 Identities = 29/46 (63%), Positives = 29/46 (63%), Gaps = 4/46 (8%) Frame = -1 Query: 415 QPAPQPAPYGQPYGYPPA---PPPAQGYPATGYPPA-AYPPPGYPP 290 Q A QPA Y P GYPP PPP QGYP GYPP YPP GYPP Sbjct: 243 QQAAQPA-YPPPQGYPPQGYPPPPPQGYPPQGYPPPQGYPPQGYPP 287 Score = 53.9 bits (128), Expect = 5e-06 Identities = 31/57 (54%), Positives = 32/57 (56%), Gaps = 5/57 (8%) Frame = -1 Query: 439 APQPAPYGQPAPQPAPYGQPYGYPPAPP---PAQGYPAT-GYPPAAYPPP-GYPPSG 284 A Q A P PQ P P GYPP PP P QGYP GYPP YPPP G PP+G Sbjct: 242 AQQAAQPAYPPPQGYP---PQGYPPPPPQGYPPQGYPPPQGYPPQGYPPPQGPPPAG 295 [85][TOP] >UniRef100_A5PLE2 UPF0467 protein C5orf32 homolog n=1 Tax=Danio rerio RepID=CE032_DANRE Length = 118 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/51 (52%), Positives = 27/51 (52%) Frame = -1 Query: 433 QPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 QP Y P P P Q GYP P QGYPA GYPP YP GYP GY Sbjct: 5 QPPAYTGPGPAPGYPAQ--GYPAQGYPTQGYPAQGYPPQGYPAQGYPAQGY 53 [86][TOP] >UniRef100_UPI0001925977 PREDICTED: similar to galectin-3 n=1 Tax=Hydra magnipapillata RepID=UPI0001925977 Length = 231 Score = 57.0 bits (136), Expect = 6e-07 Identities = 36/68 (52%), Positives = 40/68 (58%), Gaps = 15/68 (22%) Frame = -1 Query: 439 APQP-APYGQPAPQP-APYGQ------PYGYPPAP--PPAQG-----YPATGYPPAAYPP 305 AP P AP GQ AP P AP GQ P G+ P P PP QG +P T YPP+ YPP Sbjct: 47 APYPGAPSGQ-APYPGAPLGQVPYPGAPSGHAPYPGGPPTQGPYPGGHPQTNYPPSGYPP 105 Query: 304 PGYPPSGY 281 G+PPSGY Sbjct: 106 TGHPPSGY 113 [87][TOP] >UniRef100_UPI00017928E3 PREDICTED: hypothetical protein n=1 Tax=Acyrthosiphon pisum RepID=UPI00017928E3 Length = 259 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/56 (46%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = -1 Query: 442 YAPQPAPYGQPAPQ--PAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 Y P PY PQ P P P YPP P YP YPP +YPPP YPP Y Sbjct: 153 YPPPSYPYPSYPPQQYPQPSYPPPSYPPPSYPQPSYPPPSYPPPSYPPPSYPPPSY 208 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/51 (49%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = -1 Query: 430 PAPYGQPAPQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 P Y QP+ P Y P Y P PPP+ YP YPP +YPPP YPP Y Sbjct: 165 PQQYPQPSYPPPSYPPPSYPQPSYPPPS--YPPPSYPPPSYPPPSYPPPAY 213 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/53 (50%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Frame = -1 Query: 436 PQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYP-PSGY 281 PQP+ Y P+ P Y QP YPP P YP YPP +YPPP YP PS Y Sbjct: 169 PQPS-YPPPSYPPPSYPQP-SYPPPSYPPPSYPPPSYPPPSYPPPAYPQPSPY 219 [88][TOP] >UniRef100_A1UKQ7 Putative uncharacterized protein n=2 Tax=Mycobacterium RepID=A1UKQ7_MYCSK Length = 317 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/63 (47%), Positives = 32/63 (50%), Gaps = 9/63 (14%) Frame = -1 Query: 442 YAPQPAPYGQPAPQPA---PYGQPYGYPPAPPPAQGYPAT---GYPPAAY---PPPGYPP 290 Y P P P G P P P P GYPP PPP GYP YPPA Y P GYPP Sbjct: 20 YPPPPPPGGYPPPPTQGGYPPPHPGGYPPPPPPQGGYPPPPQGNYPPAGYPVRPQGGYPP 79 Query: 289 SGY 281 +G+ Sbjct: 80 AGF 82 [89][TOP] >UniRef100_C0IN06 Proline-rich family protein n=1 Tax=Cicer arietinum RepID=C0IN06_CICAR Length = 186 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/43 (58%), Positives = 28/43 (65%), Gaps = 3/43 (6%) Frame = -1 Query: 400 PAPYGQPYGYPPAP--PPAQGYPATGYPPA-AYPPPGYPPSGY 281 P Y +GYPP PP QGYP +GYPP YPP GYPP+GY Sbjct: 37 PGAYPPQHGYPPQQGYPPQQGYPPSGYPPQQGYPPQGYPPAGY 79 [90][TOP] >UniRef100_Q0D326 Rhodopsin (Fragment) n=2 Tax=Euprymna RepID=Q0D326_9MOLL Length = 298 Score = 57.0 bits (136), Expect = 6e-07 Identities = 29/45 (64%), Positives = 29/45 (64%), Gaps = 3/45 (6%) Frame = -1 Query: 415 QPAPQPAPYGQPYGYPPA--PPPAQGYPATGYPP-AAYPPPGYPP 290 Q A Q A Y P GYPP PPP QGYP GYPP AYPP GYPP Sbjct: 244 QQAQQQAAY-PPQGYPPQGYPPPPQGYPPQGYPPQGAYPPQGYPP 287 [91][TOP] >UniRef100_B8Q2W3 Opsin n=1 Tax=Euprymna scolopes RepID=B8Q2W3_9MOLL Length = 448 Score = 57.0 bits (136), Expect = 6e-07 Identities = 29/45 (64%), Positives = 29/45 (64%), Gaps = 3/45 (6%) Frame = -1 Query: 415 QPAPQPAPYGQPYGYPPA--PPPAQGYPATGYPP-AAYPPPGYPP 290 Q A Q A Y P GYPP PPP QGYP GYPP AYPP GYPP Sbjct: 384 QQAQQQAAY-PPQGYPPQGYPPPPQGYPPQGYPPQGAYPPQGYPP 427 [92][TOP] >UniRef100_B8Q2W2 Opsin n=1 Tax=Euprymna scolopes RepID=B8Q2W2_9MOLL Length = 448 Score = 57.0 bits (136), Expect = 6e-07 Identities = 29/45 (64%), Positives = 29/45 (64%), Gaps = 3/45 (6%) Frame = -1 Query: 415 QPAPQPAPYGQPYGYPPA--PPPAQGYPATGYPP-AAYPPPGYPP 290 Q A Q A Y P GYPP PPP QGYP GYPP AYPP GYPP Sbjct: 384 QQAQQQAAY-PPQGYPPQGYPPPPQGYPPQGYPPQGAYPPQGYPP 427 [93][TOP] >UniRef100_A2EVN2 XYPPX repeat family protein n=1 Tax=Trichomonas vaginalis G3 RepID=A2EVN2_TRIVA Length = 231 Score = 57.0 bits (136), Expect = 6e-07 Identities = 33/58 (56%), Positives = 34/58 (58%), Gaps = 5/58 (8%) Frame = -1 Query: 439 APQPAPYGQPAPQ--PAPYGQPY-GYPPAPP-PAQGYPATGYPPAAYPPPGYPP-SGY 281 AP AP+ QP PQ P G P GYPP P QGYP GYPP YP PGYPP GY Sbjct: 124 APNEAPF-QPRPQGYPPMGGYPQAGYPPQGGYPPQGYPQAGYPPQGYPQPGYPPQQGY 180 [94][TOP] >UniRef100_A0BKH8 Chromosome undetermined scaffold_112, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0BKH8_PARTE Length = 271 Score = 57.0 bits (136), Expect = 6e-07 Identities = 36/73 (49%), Positives = 37/73 (50%), Gaps = 15/73 (20%) Frame = -1 Query: 442 YAPQPAPY--GQPAPQPAPYGQPY----GYPPAP--PPAQGYPAT-GYPPA-AYPP---- 305 Y PQP P G P QP QPY GYPP P PP GYP GYPP YPP Sbjct: 199 YPPQPYPQQPGYPPQQPGYPAQPYPPQQGYPPQPGYPPQPGYPPQPGYPPQPGYPPQQPG 258 Query: 304 -PGYPPSGYSR*F 269 PGYP GY + F Sbjct: 259 YPGYPQQGYQKPF 271 [95][TOP] >UniRef100_C8XIP8 Membrane-flanked domain protein n=1 Tax=Nakamurella multipartita DSM 44233 RepID=C8XIP8_9ACTO Length = 479 Score = 56.6 bits (135), Expect = 8e-07 Identities = 32/72 (44%), Positives = 35/72 (48%), Gaps = 18/72 (25%) Frame = -1 Query: 436 PQPAPYGQPAPQPA-----------PYGQPYGYPPAPPPAQGYPA-------TGYPPAAY 311 P A Y QP PA P GQP GYPP P P Q YPA GYPP+ Y Sbjct: 231 PPAAGYAQPGYGPAHPQTGPTQGYPPPGQPQGYPP-PGPTQSYPAGHQPTQSPGYPPSGY 289 Query: 310 PPPGYPPSGYSR 275 GYPP+GY + Sbjct: 290 ATGGYPPNGYQQ 301 [96][TOP] >UniRef100_C4JQ73 RfeF protein n=1 Tax=Uncinocarpus reesii 1704 RepID=C4JQ73_UNCRE Length = 618 Score = 56.6 bits (135), Expect = 8e-07 Identities = 33/63 (52%), Positives = 35/63 (55%), Gaps = 12/63 (19%) Frame = -1 Query: 436 PQPAPYGQPAPQPAP---YGQPYG---YPPA---PPPAQGYP---ATGYPPAAYPPPGYP 293 PQ +PYGQP PQ P YGQP YPP PP QGYP A+GYPP P PG P Sbjct: 181 PQQSPYGQPYPQQQPQPYYGQPPQQGQYPPQSPHPPQGQGYPPQGASGYPPQGSPYPGAP 240 Query: 292 PSG 284 G Sbjct: 241 QYG 243 [97][TOP] >UniRef100_Q8LCL8 UPF0467 protein B n=1 Tax=Arabidopsis thaliana RepID=U647B_ARATH Length = 101 Score = 56.6 bits (135), Expect = 8e-07 Identities = 31/75 (41%), Positives = 36/75 (48%) Frame = -1 Query: 424 PYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR*FI*HMLCVG 245 P GQP PQ Y P GYP P QGYP GYP YP GYPP + G Sbjct: 28 PPGQPYPQQG-YPPPQGYPQQGYPPQGYPPQGYPEQGYPQQGYPPQQQQQ----QKHSPG 82 Query: 244 LLRQLIASVICFLQL 200 +L IA++ C+ L Sbjct: 83 MLEGCIAALCCYCVL 97 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/50 (54%), Positives = 27/50 (54%), Gaps = 4/50 (8%) Frame = -1 Query: 418 GQPAPQPAPYGQPY---GYPPAPP-PAQGYPATGYPPAAYPPPGYPPSGY 281 G P P GQPY GYPP P QGYP GYPP YP GYP GY Sbjct: 20 GPPKDAYPPPGQPYPQQGYPPPQGYPQQGYPPQGYPPQGYPEQGYPQQGY 69 [98][TOP] >UniRef100_B9I6F5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9I6F5_POPTR Length = 192 Score = 56.2 bits (134), Expect = 1e-06 Identities = 32/57 (56%), Positives = 34/57 (59%), Gaps = 5/57 (8%) Frame = -1 Query: 439 APQPAPYGQPAP--QPAPYGQPYGYPPAP-PPAQGYPATGYPP-AAYPPP-GYPPSG 284 AP P P+G P PA Y P GYPP+ PP GYP GYPP YPPP GYPP G Sbjct: 33 APYP-PHGYPQQGYPPAGYPPPGGYPPSGYPPPGGYPPAGYPPPGGYPPPGGYPPPG 88 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/33 (75%), Positives = 25/33 (75%), Gaps = 2/33 (6%) Frame = -1 Query: 373 YPP-APPPAQGYPATGYPPAAYPPP-GYPPSGY 281 YPP AP P GYP GYPPA YPPP GYPPSGY Sbjct: 29 YPPSAPYPPHGYPQQGYPPAGYPPPGGYPPSGY 61 Score = 55.1 bits (131), Expect = 2e-06 Identities = 29/49 (59%), Positives = 31/49 (63%), Gaps = 3/49 (6%) Frame = -1 Query: 421 YGQPAPQPAPYGQPY-GYPPAP-PPAQGYPATGYPP-AAYPPPGYPPSG 284 Y AP P P+G P GYPPA PP GYP +GYPP YPP GYPP G Sbjct: 29 YPPSAPYP-PHGYPQQGYPPAGYPPPGGYPPSGYPPPGGYPPAGYPPPG 76 Score = 54.3 bits (129), Expect = 4e-06 Identities = 31/57 (54%), Positives = 33/57 (57%), Gaps = 4/57 (7%) Frame = -1 Query: 439 APQPAPYGQPAPQPAPYGQPYGYPPA--PPPAQGYPATGYPPA-AYPPPG-YPPSGY 281 A P P G P P+ Y P GYPPA PPP P GYPP YPPPG YPP+GY Sbjct: 48 AGYPPPGGYP---PSGYPPPGGYPPAGYPPPGGYPPPGGYPPPGGYPPPGAYPPAGY 101 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/44 (59%), Positives = 29/44 (65%), Gaps = 2/44 (4%) Frame = -1 Query: 406 PQPAPYGQPYGYPPAPPPAQGYPATG-YPPAAYPPPG-YPPSGY 281 P APY P+GYP P GYP G YPP+ YPPPG YPP+GY Sbjct: 30 PPSAPY-PPHGYPQQGYPPAGYPPPGGYPPSGYPPPGGYPPAGY 72 [99][TOP] >UniRef100_A8IES3 Predicted protein (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8IES3_CHLRE Length = 699 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/53 (54%), Positives = 29/53 (54%), Gaps = 3/53 (5%) Frame = -1 Query: 439 APQPAPYGQPAPQPA--PYGQPYGYPPAPPPAQGYPATGY-PPAAYPPPGYPP 290 AP P G AP P P G P GYPP P G P GY PP AYPPPG PP Sbjct: 565 APTMHPGGHAAPPPGAPPPGAPGGYPPPGAPPPGAPGGGYPPPGAYPPPGAPP 617 [100][TOP] >UniRef100_Q6QE98 Rhodopsin (Fragment) n=1 Tax=Octopus rubescens RepID=Q6QE98_9MOLL Length = 291 Score = 56.2 bits (134), Expect = 1e-06 Identities = 31/51 (60%), Positives = 31/51 (60%), Gaps = 3/51 (5%) Frame = -1 Query: 433 QPAPYGQPAPQPAPYGQPYGYPP--APPPAQGYPATG-YPPAAYPPPGYPP 290 Q A Y QP P P Y P GYPP A PP QGYP G YPP YPP GYPP Sbjct: 243 QQAAYQQPPP-PQGY-PPQGYPPQGAYPPQQGYPXQGAYPPQGYPPQGYPP 291 [101][TOP] >UniRef100_Q3BDN8 Rhodopsin (Fragment) n=1 Tax=Rossia pacifica RepID=Q3BDN8_ROSPA Length = 305 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/45 (64%), Positives = 29/45 (64%), Gaps = 3/45 (6%) Frame = -1 Query: 415 QPAPQPAPYGQPYGYPPA--PPPAQGYPATGYPP-AAYPPPGYPP 290 Q A QPA P GYPP PPP QGYP GYPP AYPP GYPP Sbjct: 244 QQAQQPAY--PPQGYPPQGYPPPPQGYPPQGYPPQGAYPPQGYPP 286 [102][TOP] >UniRef100_A9V0Y5 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9V0Y5_MONBE Length = 117 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/50 (50%), Positives = 25/50 (50%) Frame = -1 Query: 430 PAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 P PYGQP P GYP P QGYP GYP YP GYP GY Sbjct: 19 PPPYGQPQYPQYPQYPQQGYPQQGYPQQGYPQQGYPQQGYPQQGYPQQGY 68 [103][TOP] >UniRef100_A2ED24 XYPPX repeat family protein n=1 Tax=Trichomonas vaginalis G3 RepID=A2ED24_TRIVA Length = 232 Score = 56.2 bits (134), Expect = 1e-06 Identities = 31/59 (52%), Positives = 32/59 (54%), Gaps = 3/59 (5%) Frame = -1 Query: 442 YAPQPAPYGQPAPQPAPYGQPYGYPPAP--PPAQGYPATGYPPAAYPP-PGYPPSGYSR 275 Y PQ P QP P PY P GYPP PP Q YP GYPP YPP P YPP S+ Sbjct: 149 YPPQGYPQ-QPYPPQQPY-PPQGYPPQQSYPPQQPYPPQGYPPQPYPPQPAYPPQSNSQ 205 Score = 53.1 bits (126), Expect = 9e-06 Identities = 30/61 (49%), Positives = 30/61 (49%), Gaps = 9/61 (14%) Frame = -1 Query: 436 PQPAPYG-QPAPQPAPYGQPYGYPPAP-PPAQGYPATGYPPAA-------YPPPGYPPSG 284 P P PY Q P PY P GYP P PP Q YP GYPP YPP GYPP Sbjct: 133 PAPGPYPPQGYPPQGPY-PPQGYPQQPYPPQQPYPPQGYPPQQSYPPQQPYPPQGYPPQP 191 Query: 283 Y 281 Y Sbjct: 192 Y 192 [104][TOP] >UniRef100_Q8S8M0 UPF0467 protein At2g41420 n=1 Tax=Arabidopsis thaliana RepID=U647A_ARATH Length = 98 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/48 (54%), Positives = 26/48 (54%) Frame = -1 Query: 424 PYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 P G P PQ P P GYP P QGYP GYP YPP GYP GY Sbjct: 8 PVGVPPPQGYP---PEGYPKDAYPPQGYPPQGYPQQGYPPQGYPQQGY 52 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/47 (51%), Positives = 24/47 (51%) Frame = -1 Query: 421 YGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 Y QP P P GYPP P YP GYPP YP GYPP GY Sbjct: 4 YNQP---PVGVPPPQGYPPEGYPKDAYPPQGYPPQGYPQQGYPPQGY 47 [105][TOP] >UniRef100_Q6P6R0 Glutamate [NMDA] receptor-associated protein 1 n=1 Tax=Rattus norvegicus RepID=GRINA_RAT Length = 348 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/53 (56%), Positives = 31/53 (58%), Gaps = 1/53 (1%) Frame = -1 Query: 436 PQP-APYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 P P APY Q A QP+PYGQP GYP P P YP GYP YP GYP Y Sbjct: 36 PYPGAPYPQAAFQPSPYGQP-GYPHGPGP---YPQGGYPQGPYPQGGYPQGPY 84 [106][TOP] >UniRef100_Q9ESF4 Glutamate [NMDA] receptor-associated protein 1 n=1 Tax=Mus musculus RepID=GRINA_MOUSE Length = 345 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/54 (55%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 439 APQP-APYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 AP P APY Q QP+PYGQP GYP P P YP GYP YP GYP Y Sbjct: 32 APYPGAPYPQAPFQPSPYGQP-GYPHGPSP---YPQGGYPQGPYPQGGYPQGPY 81 [107][TOP] >UniRef100_Q0D312 Rhodopsin (Fragment) n=1 Tax=Todaropsis eblanae RepID=Q0D312_9MOLL Length = 300 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/50 (54%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -1 Query: 430 PAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPP-GYPPSG 284 P Y QP P P GYPP P QGYP GYPP YPPP G PP G Sbjct: 250 PQGYAQPPP-------PQGYPPQGYPPQGYPQQGYPPQGYPPPQGAPPQG 292 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/39 (58%), Positives = 23/39 (58%), Gaps = 4/39 (10%) Frame = -1 Query: 385 QPYGYPPA----PPPAQGYPATGYPPAAYPPPGYPPSGY 281 Q YPP PPP QGYP GYPP YP GYPP GY Sbjct: 244 QQAAYPPQGYAQPPPPQGYPPQGYPPQGYPQQGYPPQGY 282 [108][TOP] >UniRef100_A2DBY2 XYPPX repeat family protein n=1 Tax=Trichomonas vaginalis G3 RepID=A2DBY2_TRIVA Length = 383 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/62 (41%), Positives = 31/62 (50%), Gaps = 12/62 (19%) Frame = -1 Query: 430 PAPYGQPAPQPAPYGQPYGYPPAPPPAQG------------YPATGYPPAAYPPPGYPPS 287 PA + + P PAPY GYPP P QG YP GYPP +PP G+PP Sbjct: 134 PANWTRQQPAPAPYPPQGGYPPQGYPPQGGYPPQGYPPQGAYPPQGYPPQGFPPQGFPPQ 193 Query: 286 GY 281 G+ Sbjct: 194 GF 195 [109][TOP] >UniRef100_B6GYL8 Pc12g12340 protein n=1 Tax=Penicillium chrysogenum Wisconsin 54-1255 RepID=B6GYL8_PENCW Length = 467 Score = 55.8 bits (133), Expect = 1e-06 Identities = 32/65 (49%), Positives = 33/65 (50%), Gaps = 13/65 (20%) Frame = -1 Query: 436 PQPAPYGQPAPQPAPYG----QPYGY--PPAPPP----AQGYPATGYPPA---AYPPPGY 296 PQ YG P Q PYG QP+GY PPA PP GY G PPA YP PG Sbjct: 75 PQQGQYGAPPAQGGPYGATPPQPHGYHAPPAQPPYGQQPHGYAPPGQPPAGGPGYPAPGQ 134 Query: 295 PPSGY 281 PP GY Sbjct: 135 PPVGY 139 Score = 55.1 bits (131), Expect = 2e-06 Identities = 34/67 (50%), Positives = 36/67 (53%), Gaps = 17/67 (25%) Frame = -1 Query: 433 QPAPYGQPAPQP---------APYG-QPYGY-PPAPPPA--QGYPATGYPPAAY--PPPG 299 Q PYG PQP PYG QP+GY PP PPA GYPA G PP Y PPPG Sbjct: 86 QGGPYGATPPQPHGYHAPPAQPPYGQQPHGYAPPGQPPAGGPGYPAPGQPPVGYGAPPPG 145 Query: 298 --YPPSG 284 +PP G Sbjct: 146 GAFPPQG 152 [110][TOP] >UniRef100_UPI0001739304 unknown protein n=1 Tax=Arabidopsis thaliana RepID=UPI0001739304 Length = 124 Score = 55.5 bits (132), Expect = 2e-06 Identities = 31/58 (53%), Positives = 31/58 (53%), Gaps = 9/58 (15%) Frame = -1 Query: 430 PAPYGQPAPQPAPYGQPYGYPPA--PPP----AQGYPATGYPPAAYP---PPGYPPSG 284 PA Y PA P P GYPPA PPP QGYPA GYPP YP PP YP G Sbjct: 26 PAGYPPPAGYPPPQYPQAGYPPAGYPPPQQGYGQGYPAQGYPPPQYPQGHPPQYPYQG 83 Score = 53.5 bits (127), Expect = 7e-06 Identities = 29/55 (52%), Positives = 29/55 (52%), Gaps = 12/55 (21%) Frame = -1 Query: 409 APQPAPYGQPYGYPPA--PPPA----QGYPATGYPPAAYPPP------GYPPSGY 281 AP P Y GYPPA PPPA YP GYPPA YPPP GYP GY Sbjct: 12 APPPQGYPPKEGYPPAGYPPPAGYPPPQYPQAGYPPAGYPPPQQGYGQGYPAQGY 66 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/59 (45%), Positives = 28/59 (47%), Gaps = 9/59 (15%) Frame = -1 Query: 430 PAPYGQPAPQ---PAPYGQPYGYPPAPPPAQGYPATGYPPA------AYPPPGYPPSGY 281 P P G P + PA Y P GYPP P GYP GYPP YP GYPP Y Sbjct: 13 PPPQGYPPKEGYPPAGYPPPAGYPPPQYPQAGYPPAGYPPPQQGYGQGYPAQGYPPPQY 71 [111][TOP] >UniRef100_UPI00005A29FC PREDICTED: similar to glutamate receptor, ionotropic, N-methyl D-asparate-associated protein 1 n=1 Tax=Canis lupus familiaris RepID=UPI00005A29FC Length = 492 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/55 (54%), Positives = 31/55 (56%), Gaps = 3/55 (5%) Frame = -1 Query: 436 PQP-APYGQPAPQPAPYGQPYGYPPAPP--PAQGYPATGYPPAAYPPPGYPPSGY 281 P P APY QP QP+PYGQP GYP P P GYP YP YP YP GY Sbjct: 167 PYPGAPYPQPPFQPSPYGQP-GYPQGPGSYPQGGYPQGPYPQDPYPQGPYPQGGY 220 [112][TOP] >UniRef100_UPI00004A576B glutamate receptor, ionotropic, N-methyl D-asparate-associated protein 1 n=1 Tax=Canis lupus familiaris RepID=UPI00004A576B Length = 356 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/55 (54%), Positives = 31/55 (56%), Gaps = 3/55 (5%) Frame = -1 Query: 436 PQP-APYGQPAPQPAPYGQPYGYPPAPP--PAQGYPATGYPPAAYPPPGYPPSGY 281 P P APY QP QP+PYGQP GYP P P GYP YP YP YP GY Sbjct: 31 PYPGAPYPQPPFQPSPYGQP-GYPQGPGSYPQGGYPQGPYPQDPYPQGPYPQGGY 84 [113][TOP] >UniRef100_B1XZX1 Putative uncharacterized protein n=1 Tax=Leptothrix cholodnii SP-6 RepID=B1XZX1_LEPCP Length = 307 Score = 55.5 bits (132), Expect = 2e-06 Identities = 31/58 (53%), Positives = 33/58 (56%), Gaps = 4/58 (6%) Frame = -1 Query: 442 YAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPAT----GYPPAAYPPPGYPPSGY 281 +AP AP PAP PA + QP PP PA YPA GYP AA PPPGY P GY Sbjct: 105 FAPAYAPRAMPAPPPAQW-QP---PPMAAPAPYYPAAQVPPGYPGAAMPPPGYAPPGY 158 [114][TOP] >UniRef100_Q9M2X4 Putative uncharacterized protein T16K5.190 n=1 Tax=Arabidopsis thaliana RepID=Q9M2X4_ARATH Length = 651 Score = 55.5 bits (132), Expect = 2e-06 Identities = 31/58 (53%), Positives = 31/58 (53%), Gaps = 9/58 (15%) Frame = -1 Query: 430 PAPYGQPAPQPAPYGQPYGYPPA--PPP----AQGYPATGYPPAAYP---PPGYPPSG 284 PA Y PA P P GYPPA PPP QGYPA GYPP YP PP YP G Sbjct: 553 PAGYPPPAGYPPPQYPQAGYPPAGYPPPQQGYGQGYPAQGYPPPQYPQGHPPQYPYQG 610 Score = 53.5 bits (127), Expect = 7e-06 Identities = 29/55 (52%), Positives = 29/55 (52%), Gaps = 12/55 (21%) Frame = -1 Query: 409 APQPAPYGQPYGYPPA--PPPA----QGYPATGYPPAAYPPP------GYPPSGY 281 AP P Y GYPPA PPPA YP GYPPA YPPP GYP GY Sbjct: 539 APPPQGYPPKEGYPPAGYPPPAGYPPPQYPQAGYPPAGYPPPQQGYGQGYPAQGY 593 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/59 (45%), Positives = 28/59 (47%), Gaps = 9/59 (15%) Frame = -1 Query: 430 PAPYGQPAPQ---PAPYGQPYGYPPAPPPAQGYPATGYPPA------AYPPPGYPPSGY 281 P P G P + PA Y P GYPP P GYP GYPP YP GYPP Y Sbjct: 540 PPPQGYPPKEGYPPAGYPPPAGYPPPQYPQAGYPPAGYPPPQQGYGQGYPAQGYPPPQY 598 [115][TOP] >UniRef100_Q0WPY7 Putative uncharacterized protein At3g49840 (Fragment) n=1 Tax=Arabidopsis thaliana RepID=Q0WPY7_ARATH Length = 111 Score = 55.5 bits (132), Expect = 2e-06 Identities = 31/58 (53%), Positives = 31/58 (53%), Gaps = 9/58 (15%) Frame = -1 Query: 430 PAPYGQPAPQPAPYGQPYGYPPA--PPP----AQGYPATGYPPAAYP---PPGYPPSG 284 PA Y PA P P GYPPA PPP QGYPA GYPP YP PP YP G Sbjct: 13 PAGYPPPAGYPPPQYPQAGYPPAGYPPPQQGYGQGYPAQGYPPPQYPQGHPPQYPYQG 70 [116][TOP] >UniRef100_C6SWT5 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6SWT5_SOYBN Length = 170 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/50 (52%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -1 Query: 424 PYGQPAPQPAPYGQPYGYPPAPPPAQGYPA-TGYPPAAYPPPGYPPSGYS 278 P G P P Y GYPPA P GYP GYPPA YPP GYP S ++ Sbjct: 35 PPGAYPPPPGAYPPQQGYPPAGYPPAGYPPHQGYPPAGYPPAGYPGSSHA 84 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/47 (57%), Positives = 29/47 (61%), Gaps = 10/47 (21%) Frame = -1 Query: 391 YGQPYG-YPPAP---PPAQGYPATGYPPAAYPP------PGYPPSGY 281 +G P G YPP P PP QGYP GYPPA YPP GYPP+GY Sbjct: 32 HGYPPGAYPPPPGAYPPQQGYPPAGYPPAGYPPHQGYPPAGYPPAGY 78 [117][TOP] >UniRef100_B9I8M8 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9I8M8_POPTR Length = 81 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/50 (60%), Positives = 31/50 (62%) Frame = -1 Query: 424 PYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 275 P+ APQ A YGQPYGYPP PP Q GYPPA P YPP GYSR Sbjct: 39 PHAGYAPQQA-YGQPYGYPP-PPQTQ-----GYPPAYPQPHAYPPHGYSR 81 [118][TOP] >UniRef100_Q6QE87 Rhodopsin (Fragment) n=1 Tax=Idiosepius notoides RepID=Q6QE87_9MOLL Length = 316 Score = 55.5 bits (132), Expect = 2e-06 Identities = 32/60 (53%), Positives = 32/60 (53%), Gaps = 7/60 (11%) Frame = -1 Query: 442 YAPQPA--PYGQPAPQPAPYGQPYGYPPAP----PPAQGYPATGYPPAAYPPP-GYPPSG 284 Y PQ A P G PQ P P GYPP P PP GYP GYPP YPPP G PP G Sbjct: 247 YPPQGAYPPQGAYPPQGYP-PPPAGYPPPPAGYPPPQGGYPPQGYPPQGYPPPQGAPPQG 305 [119][TOP] >UniRef100_Q3BDP5 Rhodopsin (Fragment) n=1 Tax=Joubiniteuthis sp. JMS-2004 RepID=Q3BDP5_9MOLL Length = 283 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/45 (57%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -1 Query: 415 QPAPQPAPYGQPYGYPPAP-PPAQGYPATGYPPAAYPPPGYPPSG 284 QPA Y GYPP PPAQGYP GYPP YPP G PP G Sbjct: 230 QPAYPQQGYPPAQGYPPQGYPPAQGYPPQGYPPQGYPPQGAPPXG 274 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/46 (60%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = -1 Query: 415 QPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPA-AYPPPGYPPSGY 281 Q A QPA Q Y PPAQGYP GYPPA YPP GYPP GY Sbjct: 226 QQAQQPAYPQQGY------PPAQGYPPQGYPPAQGYPPQGYPPQGY 265 [120][TOP] >UniRef100_B4YS71 Rhodopsin (Fragment) n=1 Tax=Alloteuthis africana RepID=B4YS71_9MOLL Length = 303 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/46 (60%), Positives = 28/46 (60%), Gaps = 4/46 (8%) Frame = -1 Query: 415 QPAPQPAPYGQPYGYPPA---PPPAQGYPATGYPPA-AYPPPGYPP 290 Q QPA Y P GYPP PPP QGYP GYPP YPP GYPP Sbjct: 243 QQQQQPA-YPPPQGYPPQGYPPPPPQGYPPQGYPPPQGYPPQGYPP 287 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/48 (56%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = -1 Query: 430 PAPYGQPAPQPAPYGQPYGYPPAP-PPAQGYPATGYPPAAYPPPGYPP 290 P P G P PQ P P GYPP PP QGYP GYPP PPP PP Sbjct: 251 PPPQGYP-PQGYPPPPPQGYPPQGYPPPQGYPPQGYPPPQGPPPQGPP 297 [121][TOP] >UniRef100_A2FGL4 Putative uncharacterized protein n=1 Tax=Trichomonas vaginalis G3 RepID=A2FGL4_TRIVA Length = 614 Score = 55.5 bits (132), Expect = 2e-06 Identities = 31/57 (54%), Positives = 33/57 (57%), Gaps = 6/57 (10%) Frame = -1 Query: 433 QPAPYGQPAPQPAPYGQP---YGYPPAPPPAQGYPATGY-PPAAYPPPGY--PPSGY 281 QP+PYG P P +PYG P YGY PPP G P GY P PPPGY PP GY Sbjct: 525 QPSPYGAP-PSQSPYGSPPPGYGY---PPPGYGSPPPGYGAPYGAPPPGYGAPPPGY 577 [122][TOP] >UniRef100_Q2H239 Putative uncharacterized protein n=1 Tax=Chaetomium globosum RepID=Q2H239_CHAGB Length = 904 Score = 55.5 bits (132), Expect = 2e-06 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 12/66 (18%) Frame = -1 Query: 442 YAPQPAP--YGQ----PAP----QPAPYGQPYGYPPAP-PPAQGYPATG-YPPAAYPPPG 299 Y P P P YGQ PAP Q +PYG P YPPA PPA GY A G PP A PPP Sbjct: 283 YQPPPPPPHYGQYPAPPAPPQYVQQSPYGPP-SYPPAQYPPAPGYYAPGAAPPPAPPPPS 341 Query: 298 YPPSGY 281 YPP Y Sbjct: 342 YPPGTY 347 [123][TOP] >UniRef100_UPI000155636D PREDICTED: hypothetical protein n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155636D Length = 179 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/71 (42%), Positives = 33/71 (46%), Gaps = 15/71 (21%) Frame = -1 Query: 442 YAPQP---APYGQPAPQPAPYGQPY------------GYPPAPPPAQGYPATGYPPAAYP 308 YA P APY QP QP PYGQP GYP P P YP GYP YP Sbjct: 32 YAQPPYPVAPYPQPTFQPGPYGQPGYPQGPPGPYPQGGYPQGPYPQGPYPQGGYPQGPYP 91 Query: 307 PPGYPPSGYSR 275 +PP+ Y + Sbjct: 92 QGPFPPNPYGQ 102 [124][TOP] >UniRef100_UPI0000587BAF PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000587BAF Length = 144 Score = 55.1 bits (131), Expect = 2e-06 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 14/65 (21%) Frame = -1 Query: 439 APQPAPYGQPAPQPAPYGQPYGYPPAP-----PPAQGYP--ATGYPPAA---YPPP---- 302 AP P G PQ Y QP GYP AP PP GYP A GYPPAA YPPP Sbjct: 10 APYPQQGGGYPPQAGGYPQPGGYPQAPAPAGYPPQGGYPPAAGGYPPAAGGGYPPPAGAG 69 Query: 301 GYPPS 287 GYPP+ Sbjct: 70 GYPPA 74 Score = 55.1 bits (131), Expect = 2e-06 Identities = 34/66 (51%), Positives = 35/66 (53%), Gaps = 14/66 (21%) Frame = -1 Query: 442 YAPQPAPYGQP-----APQPAPYGQPYGYPPAP---PPAQG--YP----ATGYPPAAYPP 305 Y PQ Y QP AP PA Y GYPPA PPA G YP A GYPPA P Sbjct: 19 YPPQAGGYPQPGGYPQAPAPAGYPPQGGYPPAAGGYPPAAGGGYPPPAGAGGYPPAPAPA 78 Query: 304 PGYPPS 287 PGYPP+ Sbjct: 79 PGYPPA 84 [125][TOP] >UniRef100_Q70YQ5 PGYRP protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q70YQ5_CHLRE Length = 169 Score = 55.1 bits (131), Expect = 2e-06 Identities = 33/59 (55%), Positives = 33/59 (55%), Gaps = 7/59 (11%) Frame = -1 Query: 436 PQPAPYGQPAPQPAPYGQPY--GYPPAP--PPAQGY-PATGY-PPAAYPPPGYPPS-GY 281 P PA Y PAP G P GYPP P PP GY P GY PPA YP PGYPP GY Sbjct: 19 PPPAGYPPQPGYPAPAGYPPQPGYPPQPGYPPQPGYPPQPGYPPPAGYPAPGYPPQPGY 77 Score = 54.7 bits (130), Expect = 3e-06 Identities = 35/65 (53%), Positives = 36/65 (55%), Gaps = 13/65 (20%) Frame = -1 Query: 442 YAPQP---APYGQPA-----PQPAPYGQPYGYPPAP--PPAQGYPATGYPP-AAYPPP-- 302 Y PQP AP G P PQP QP GYPP P PP GYPA GYPP YPP Sbjct: 24 YPPQPGYPAPAGYPPQPGYPPQPGYPPQP-GYPPQPGYPPPAGYPAPGYPPQPGYPPAPH 82 Query: 301 GYPPS 287 GYPP+ Sbjct: 83 GYPPA 87 [126][TOP] >UniRef100_C6T3K1 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T3K1_SOYBN Length = 183 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = -1 Query: 406 PQPAPYGQPYGYPPAP-PPAQGYPATGYPPAAYP-PPGYPPSGY 281 P PY P+GYPP+ PP GYP T YPP AYP P YP SGY Sbjct: 24 PSAPPYPPPHGYPPSGYPPPGGYPPTAYPPPAYPPPGVYPHSGY 67 [127][TOP] >UniRef100_A8J964 Predicted protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8J964_CHLRE Length = 148 Score = 55.1 bits (131), Expect = 2e-06 Identities = 28/56 (50%), Positives = 31/56 (55%), Gaps = 2/56 (3%) Frame = -1 Query: 436 PQPAP-YGQPAPQPAPYGQPYGYPP-APPPAQGYPATGYPPAAYPPPGYPPSGYSR 275 P P P YG P P+PY P GYPP PPP GY P YPPPG PP Y++ Sbjct: 52 PPPGPGYGAPPAYPSPYSAPPGYPPQGPPPPPGY------PGGYPPPG-PPGAYAQ 100 [128][TOP] >UniRef100_B2B343 Predicted CDS Pa_6_1130 n=1 Tax=Podospora anserina RepID=B2B343_PODAN Length = 505 Score = 55.1 bits (131), Expect = 2e-06 Identities = 31/57 (54%), Positives = 32/57 (56%), Gaps = 10/57 (17%) Frame = -1 Query: 436 PQPAPYGQPAPQP--APYGQPYGYPP------APPPAQGY--PATGYPPAAYPPPGY 296 P P PYG P+PQP AP QPYG PP APPPAQ Y P G P A PP Y Sbjct: 51 PPPQPYGAPSPQPYGAPSPQPYGAPPPAQPYGAPPPAQPYGAPPPGQPYGAPPPQPY 107 [129][TOP] >UniRef100_P31356 Rhodopsin n=1 Tax=Todarodes pacificus RepID=OPSD_TODPA Length = 448 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/38 (65%), Positives = 25/38 (65%), Gaps = 3/38 (7%) Frame = -1 Query: 385 QPYGYPP---APPPAQGYPATGYPPAAYPPPGYPPSGY 281 Q YPP APPP QGYP GYPP YPP GYPP GY Sbjct: 384 QQAAYPPQGYAPPP-QGYPPQGYPPQGYPPQGYPPQGY 420 [130][TOP] >UniRef100_UPI0000E49F56 PREDICTED: similar to annexin A6 n=2 Tax=Strongylocentrotus purpuratus RepID=UPI0000E49F56 Length = 302 Score = 54.7 bits (130), Expect = 3e-06 Identities = 33/60 (55%), Positives = 34/60 (56%), Gaps = 9/60 (15%) Frame = -1 Query: 439 APQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYP--ATGYPPAA---YPPP----GYPPS 287 AP P G PQ Y QP GYP AP PA GYP GYPPAA YPPP GYPP+ Sbjct: 10 APYPQQGGGYPPQAGGYPQPGGYPQAPAPA-GYPPQGGGYPPAAGGGYPPPAGAGGYPPA 68 [131][TOP] >UniRef100_Q569D7 MGC107973 protein n=1 Tax=Xenopus (Silurana) tropicalis RepID=Q569D7_XENTR Length = 347 Score = 54.7 bits (130), Expect = 3e-06 Identities = 33/57 (57%), Positives = 33/57 (57%), Gaps = 5/57 (8%) Frame = -1 Query: 436 PQPAPYGQPA--PQPAPYGQPYGYPPAPPPAQGYPATGYP-PAAYP-PPGYP-PSGY 281 PQP Y QP PQP Y QP GYP PP A G PA YP P YP P GYP P GY Sbjct: 29 PQPGGYPQPGGYPQPGGYPQPGGYP--PPGAYGQPAGYYPQPGGYPAPSGYPQPGGY 83 [132][TOP] >UniRef100_Q9C4Z8 Putative uncharacterized protein F27M3_5 n=1 Tax=Arabidopsis thaliana RepID=Q9C4Z8_ARATH Length = 176 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/52 (53%), Positives = 28/52 (53%), Gaps = 5/52 (9%) Frame = -1 Query: 424 PYGQPAPQPAPYGQPYGYPPA--PPPAQGYPATGYPP--AAYPPPGYP-PSG 284 P P P Y P GYPP PPP GYP YPP AYPP GYP PSG Sbjct: 26 PGAYPPPPQGAYPPPGGYPPQGYPPPPHGYPPAAYPPPPGAYPPAGYPGPSG 77 [133][TOP] >UniRef100_Q8LEP5 Putative glycine and proline-rich protein n=1 Tax=Arabidopsis thaliana RepID=Q8LEP5_ARATH Length = 176 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/52 (53%), Positives = 28/52 (53%), Gaps = 5/52 (9%) Frame = -1 Query: 424 PYGQPAPQPAPYGQPYGYPPA--PPPAQGYPATGYPP--AAYPPPGYP-PSG 284 P P P Y P GYPP PPP GYP YPP AYPP GYP PSG Sbjct: 26 PGAYPPPPQGAYPPPGGYPPQGYPPPPHGYPPAAYPPPPGAYPPAGYPGPSG 77 [134][TOP] >UniRef100_B7FMM9 Putative uncharacterized protein n=1 Tax=Medicago truncatula RepID=B7FMM9_MEDTR Length = 91 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/51 (50%), Positives = 26/51 (50%) Frame = -1 Query: 433 QPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 Q P G P PQ P YPP P QGYP GYPP YP GYP GY Sbjct: 8 QQPPVGVPPPQGYPPKD--AYPPPGYPQQGYPQQGYPPQGYPQQGYPQQGY 56 [135][TOP] >UniRef100_A9RUJ4 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RUJ4_PHYPA Length = 273 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/62 (46%), Positives = 32/62 (51%), Gaps = 9/62 (14%) Frame = -1 Query: 439 APQPAPYGQPAPQPAPY------GQPYGYPPAPPPAQGYPA---TGYPPAAYPPPGYPPS 287 AP P PY +P PQP Y PY +P + P G PA GY AY PGYPPS Sbjct: 206 APPPVPYPRPQPQPVAYVATPPAQPPYYHPASAPVHPGAPAYHNPGYQNPAYQNPGYPPS 265 Query: 286 GY 281 GY Sbjct: 266 GY 267 [136][TOP] >UniRef100_B5DPT7 GA23811 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DPT7_DROPS Length = 561 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/48 (52%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = -1 Query: 424 PYGQPAPQPAPYGQPY-GYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 284 P G P + P G P GYPP PAQGYP GYPP YP PG+ G Sbjct: 18 PAGYPPQEYPPQGYPQQGYPPQGYPAQGYPQQGYPPQGYPQPGFIQQG 65 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/56 (46%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Frame = -1 Query: 442 YAPQPAPYGQ--PAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 +A PA + PA P P GYP P QGYPA GYP YPP GYP G+ Sbjct: 6 FAAPPAGFSSAPPAGYPPQEYPPQGYPQQGYPPQGYPAQGYPQQGYPPQGYPQPGF 61 [137][TOP] >UniRef100_B4YS88 Rhodopsin (Fragment) n=1 Tax=Alloteuthis media RepID=B4YS88_9MOLL Length = 309 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/47 (59%), Positives = 28/47 (59%), Gaps = 2/47 (4%) Frame = -1 Query: 415 QPAPQPAPYGQPYGYPPA--PPPAQGYPATGYPPAAYPPPGYPPSGY 281 Q QPA Y P GYPP PPP QGYP GYPP P GYPP GY Sbjct: 243 QQQQQPA-YPPPQGYPPQGYPPPPQGYPPQGYPP----PQGYPPQGY 284 [138][TOP] >UniRef100_Q9FCJ3 Putative uncharacterized protein SCO5195 n=1 Tax=Streptomyces coelicolor RepID=Q9FCJ3_STRCO Length = 584 Score = 54.3 bits (129), Expect = 4e-06 Identities = 30/61 (49%), Positives = 31/61 (50%), Gaps = 6/61 (9%) Frame = -1 Query: 439 APQPAPYGQPAP--QPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGY----PPSGYS 278 AP PAPYGQP Q PYGQ G PPP G P P A PPPGY P GY Sbjct: 275 APAPAPYGQPGQPGQQPPYGQVLGQTAPPPPGYGQPQA--PQAPAPPPGYGQPTAPPGYG 332 Query: 277 R 275 + Sbjct: 333 Q 333 [139][TOP] >UniRef100_B1HT22 Putative uncharacterized protein n=1 Tax=Lysinibacillus sphaericus C3-41 RepID=B1HT22_LYSSC Length = 153 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/51 (52%), Positives = 27/51 (52%), Gaps = 5/51 (9%) Frame = -1 Query: 427 APYGQ--PAPQPAPYGQPY---GYPPAPPPAQGYPATGYPPAAYPPPGYPP 290 AP G P P P PY PY YPP P P Q YP YPP YPP YPP Sbjct: 64 APPGNSYPPPYPPPYPTPYPPQPYPPRPYPPQPYPPRPYPPRPYPPQPYPP 114 [140][TOP] >UniRef100_B0CS37 Predicted protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0CS37_LACBS Length = 335 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/51 (49%), Positives = 25/51 (49%) Frame = -1 Query: 436 PQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 284 P P G P P P P P G PP P G P G PP PPPG PPSG Sbjct: 173 PPGPPPGSPPPGPPPGSPPPGSPPPGSPPPGSPPPGSPPPGSPPPGSPPSG 223 [141][TOP] >UniRef100_UPI0001AEECC4 hypothetical protein SalbJ_08409 n=1 Tax=Streptomyces albus J1074 RepID=UPI0001AEECC4 Length = 326 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/52 (50%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = -1 Query: 433 QPAPYGQPAPQPAPYGQ--PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 284 QP PYG QP PYGQ P G PP P GYP G P P GYP G Sbjct: 5 QPGPYGGQPQQPGPYGQQPPQGPPPGGQPGYGYPQQGGAPQQQPGYGYPQQG 56 [142][TOP] >UniRef100_B1VXA9 Putative uncharacterized protein n=1 Tax=Streptomyces griseus subsp. griseus NBRC 13350 RepID=B1VXA9_STRGG Length = 337 Score = 53.9 bits (128), Expect = 5e-06 Identities = 29/53 (54%), Positives = 29/53 (54%), Gaps = 5/53 (9%) Frame = -1 Query: 433 QPAPYGQPAPQ--PAPYGQ---PYGYPPAPPPAQGYPATGYPPAAYPPPGYPP 290 QP PYG PQ P PYGQ PYG PP P QG P GYP A P G PP Sbjct: 5 QPGPYGGQPPQGQPGPYGQQPGPYGAPPPQGPPQGQPGYGYPQQA--PQGVPP 55 [143][TOP] >UniRef100_B6T850 Adhesive/proline-rich protein n=1 Tax=Zea mays RepID=B6T850_MAIZE Length = 102 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/54 (51%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = -1 Query: 439 APQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPP-PGYPPSGY 281 AP Y P P P GY PPPAQGYP GYPP YPP GYP GY Sbjct: 13 APPAXGYPGKDAYPPPGYPPAGY---PPPAQGYPPQGYPPQGYPPQQGYPQQGY 63 [144][TOP] >UniRef100_B4FEM0 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FEM0_MAIZE Length = 102 Score = 53.9 bits (128), Expect = 5e-06 Identities = 30/62 (48%), Positives = 30/62 (48%), Gaps = 11/62 (17%) Frame = -1 Query: 442 YAPQPAPYGQPAPQPAPYGQPY---GYPPA--PPPAQGYPATGYPPAAYP------PPGY 296 Y Q P P Q P Y GYPPA PPPAQGYP GYPP YP GY Sbjct: 4 YGQQQPPVSAPPAQGYPGKDAYPPPGYPPAGYPPPAQGYPPQGYPPQGYPPQQGYPQQGY 63 Query: 295 PP 290 PP Sbjct: 64 PP 65 [145][TOP] >UniRef100_A9NLR5 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NLR5_PICSI Length = 95 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -1 Query: 370 PPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 P PP QGYP GYP AYPPPGYPP GY Sbjct: 10 PVGVPPPQGYPPEGYPKDAYPPPGYPPQGY 39 Score = 53.1 bits (126), Expect = 9e-06 Identities = 29/56 (51%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Frame = -1 Query: 442 YAPQPAPYGQPAPQP-APYGQPY-GYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 Y Q P G P PQ P G P YPP P QGYP GYPP YP GYP GY Sbjct: 4 YNQQQPPVGVPPPQGYPPEGYPKDAYPPPGYPPQGYPQ-GYPPQGYPAQGYPQQGY 58 [146][TOP] >UniRef100_C3Y001 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae RepID=C3Y001_BRAFL Length = 288 Score = 53.9 bits (128), Expect = 5e-06 Identities = 35/62 (56%), Positives = 37/62 (59%), Gaps = 12/62 (19%) Frame = -1 Query: 436 PQPAPYGQPAPQ---PAPYGQPY--GYPPAP--PPAQGY-PATGYPPAA--YPPP--GYP 293 P PYG P P P P GQ + GYPPA PPA GY PA GYPPAA YPP GYP Sbjct: 37 PPANPYGGPPPSSGPPPPPGQGFAGGYPPAGGYPPAGGYPPAGGYPPAAGGYPPAGGGYP 96 Query: 292 PS 287 P+ Sbjct: 97 PA 98 Score = 53.5 bits (127), Expect = 7e-06 Identities = 31/58 (53%), Positives = 33/58 (56%), Gaps = 7/58 (12%) Frame = -1 Query: 436 PQPAPYGQPAPQPAPYGQPYGYP-----PAPPPAQGYPATGYPPA-AYPPP-GYPPSG 284 PQP PAP P PYG P P PPP QG+ A GYPPA YPP GYPP+G Sbjct: 23 PQPTQGYPPAPGGYPPANPYGGPPPSSGPPPPPGQGF-AGGYPPAGGYPPAGGYPPAG 79 [147][TOP] >UniRef100_B9Q1I7 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii GT1 RepID=B9Q1I7_TOXGO Length = 314 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/55 (49%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Frame = -1 Query: 442 YAPQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPG--YPPSG 284 Y QP P PA P G P Y PPP YP+ G PP YPPPG YPP G Sbjct: 171 YVTQPVPTTPPAAAAVPTGIPPAYQ-TPPPGPYYPSPGQPPQYYPPPGGSYPPPG 224 [148][TOP] >UniRef100_P37705 Glycine-rich protein A3 n=1 Tax=Daucus carota RepID=GRP3_DAUCA Length = 195 Score = 53.9 bits (128), Expect = 5e-06 Identities = 29/59 (49%), Positives = 31/59 (52%), Gaps = 11/59 (18%) Frame = -1 Query: 424 PYGQPAPQPAPYGQPYGYPPA---------PPPAQGYPATGYPPAA--YPPPGYPPSGY 281 P GQ P Y P GYPPA PP GYP GYPPA YPP GYPP+G+ Sbjct: 29 PPGQYPPAAGGY-PPQGYPPAGGGYPPQGYPPAGGGYPPQGYPPAGGGYPPQGYPPAGH 86 [149][TOP] >UniRef100_UPI0001B4CAEE hypothetical protein SvirD4_13591 n=1 Tax=Streptomyces viridochromogenes DSM 40736 RepID=UPI0001B4CAEE Length = 315 Score = 53.5 bits (127), Expect = 7e-06 Identities = 30/57 (52%), Positives = 30/57 (52%), Gaps = 9/57 (15%) Frame = -1 Query: 433 QPAPYGQPAPQPAPYGQ--PYGYPP-APPPAQGYPATGYPPA---AYP---PPGYPP 290 QP PYG QP PYGQ PYG PP AP P GYP PP YP P G PP Sbjct: 5 QPGPYGGQPQQPGPYGQPGPYGQPPQAPQPGYGYPQQAPPPQPGYGYPQQAPQGVPP 61 [150][TOP] >UniRef100_B2HNB7 Proline and glycine rich transmembrane protein n=1 Tax=Mycobacterium marinum M RepID=B2HNB7_MYCMM Length = 377 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/54 (51%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = -1 Query: 439 APQPAP-YGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 AP P P YG P P P YG P PP PPP G GY P Y PP PP GY Sbjct: 53 APPPPPGYGTPPPPPG-YGTP---PPPPPPGYGQAPGGYAPPGYNPPPPPPPGY 102 [151][TOP] >UniRef100_Q5SDR1 Putative membrane protein n=1 Tax=Mycobacterium marinum RepID=Q5SDR1_MYCMR Length = 377 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/54 (51%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = -1 Query: 439 APQPAP-YGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 AP P P YG P P P YG P PP PPP G GY P Y PP PP GY Sbjct: 53 APPPPPGYGTPPPPPG-YGTP---PPPPPPGYGQAPGGYAPPGYNPPPPPPPGY 102 [152][TOP] >UniRef100_C1ZAA7 FHA domain-containing protein n=1 Tax=Planctomyces limnophilus DSM 3776 RepID=C1ZAA7_PLALI Length = 350 Score = 53.5 bits (127), Expect = 7e-06 Identities = 29/62 (46%), Positives = 29/62 (46%), Gaps = 8/62 (12%) Frame = -1 Query: 442 YAPQPAPYGQPAPQPAPY----GQPYGYPPAPPPAQGYPATGYP----PAAYPPPGYPPS 287 Y PQP P G P Q Y GYP A PA YP GYP PA YP PGYP Sbjct: 197 YPPQPYPAGMPQYQNPQYPGMTNPGMGYPNAGYPAASYPPAGYPQGMYPAGYPMPGYPQQ 256 Query: 286 GY 281 Y Sbjct: 257 AY 258 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/56 (50%), Positives = 30/56 (53%), Gaps = 8/56 (14%) Frame = -1 Query: 424 PYGQPAPQPAPYGQPY----GYPPAPPPAQGYPATGYPPAAYPPPGYP----PSGY 281 P G P PQP P G P YP P GYP GYP A+YPP GYP P+GY Sbjct: 194 PQGYP-PQPYPAGMPQYQNPQYPGMTNPGMGYPNAGYPAASYPPAGYPQGMYPAGY 248 [153][TOP] >UniRef100_B4YS96 Rhodopsin (Fragment) n=1 Tax=Alloteuthis subulata RepID=B4YS96_LOLSU Length = 299 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/43 (60%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Frame = -1 Query: 415 QPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPA-AYPPPGYPP 290 QPA P P GYPP PP QGYP GYPP YPP GYPP Sbjct: 247 QPAYPPQQGYPPQGYPPPPP--QGYPPQGYPPPQGYPPQGYPP 287 [154][TOP] >UniRef100_B4LEQ7 GJ11716 n=1 Tax=Drosophila virilis RepID=B4LEQ7_DROVI Length = 562 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/53 (49%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = -1 Query: 436 PQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPP-AAYPPPGYPPSGY 281 P P YG + AP G YPP P GYP GYPP +YP PGYPP Y Sbjct: 8 PDPPSYGFTS---APPGGSQNYPPQGYPQHGYPPQGYPPQTSYPQPGYPPQNY 57 [155][TOP] >UniRef100_B3LVA1 GF18588 n=1 Tax=Drosophila ananassae RepID=B3LVA1_DROAN Length = 273 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/48 (52%), Positives = 25/48 (52%) Frame = -1 Query: 436 PQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYP 293 P P G PA P P G P GYP PPP G P GYP PPPG P Sbjct: 29 PPGVPLGYPAQPPPPPGVPLGYPAQPPPPPGVP-LGYPAQPPPPPGVP 75 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/48 (52%), Positives = 25/48 (52%) Frame = -1 Query: 436 PQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYP 293 P P G PA P P G P GYP PPP G P GYP PPPG P Sbjct: 57 PPGVPLGYPAQPPPPPGVPLGYPAQPPPPPGVP-LGYPAQPPPPPGVP 103 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/48 (52%), Positives = 25/48 (52%) Frame = -1 Query: 436 PQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYP 293 P P G PA P P G P GYP PPP G P GYP PPPG P Sbjct: 85 PPGVPLGYPAQPPPPPGVPLGYPAQPPPPPGVP-LGYPAQPPPPPGVP 131 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/48 (52%), Positives = 25/48 (52%) Frame = -1 Query: 436 PQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYP 293 P P G PA P P G P GYP PPP G P GYP PPPG P Sbjct: 113 PPGVPLGYPAQPPPPPGVPLGYPAQPPPPPGVP-LGYPAQPPPPPGVP 159 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/48 (52%), Positives = 25/48 (52%) Frame = -1 Query: 436 PQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYP 293 P P G PA P P G P GYP PPP G P GYP PPPG P Sbjct: 127 PPGVPLGYPAQPPPPPGVPLGYPAQPPPPPGVPL-GYPAQPPPPPGVP 173 [156][TOP] >UniRef100_A2EEE7 Putative uncharacterized protein n=1 Tax=Trichomonas vaginalis G3 RepID=A2EEE7_TRIVA Length = 156 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/57 (47%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = -1 Query: 442 YAPQPAPYGQPAPQPAPYGQPY---GYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 281 Y PQ Y QP PQ Q Y YPP P P Q YP YP YPP YP GY Sbjct: 66 YPPQQY-YQQPYPQQPAQSQQYPPQSYPPQPYPPQNYPPQNYPQQEYPPQNYPQQGY 121 [157][TOP] >UniRef100_Q3UMQ8 H/ACA ribonucleoprotein complex non-core subunit NAF1 n=2 Tax=Mus musculus RepID=NAF1_MOUSE Length = 489 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/51 (50%), Positives = 28/51 (54%) Frame = -1 Query: 436 PQPAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 284 P PAP G+P P PAP P G PP PPPA + A G PP P PP G Sbjct: 42 PPPAPSGRPPPPPAPSSDPGGRPP-PPPAPNWDAGGRPPPPPAPNSDPPPG 91 [158][TOP] >UniRef100_UPI00015B501E PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B501E Length = 406 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/52 (53%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = -1 Query: 442 YAPQPAP-YGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPP 290 YAP P P YG PAP P P P PP PPPA P PP AY PP PP Sbjct: 318 YAPPPPPAYGPPAPPPPPPPPPAYAPPPPPPAYAPPP---PPPAYAPPPPPP 366 [159][TOP] >UniRef100_B2HS38 Proline and glycine rich transmembrane protein n=1 Tax=Mycobacterium marinum M RepID=B2HS38_MYCMM Length = 222 Score = 53.1 bits (126), Expect = 9e-06 Identities = 30/74 (40%), Positives = 32/74 (43%), Gaps = 21/74 (28%) Frame = -1 Query: 439 APQPAPYGQPAPQP--APYGQPYGYPPAPPPAQGYPATGYPPAAY--------------- 311 A P P QP+ QP P P+ P A PA YPA YPP AY Sbjct: 16 AASPPPGEQPSEQPFSPPPDAPWAAPEAASPADDYPAPSYPPPAYPPEPVGPGGYPPDYA 75 Query: 310 ----PPPGYPPSGY 281 PPPGYPP GY Sbjct: 76 TGYPPPPGYPPPGY 89 [160][TOP] >UniRef100_A0R2X6 Putative uncharacterized protein n=1 Tax=Mycobacterium smegmatis str. MC2 155 RepID=A0R2X6_MYCS2 Length = 377 Score = 53.1 bits (126), Expect = 9e-06 Identities = 31/65 (47%), Positives = 32/65 (49%), Gaps = 12/65 (18%) Frame = -1 Query: 442 YAPQPAPYGQPAPQPA--PYGQPYGYPPAPPPAQG-YP------ATGYPPAAY---PPPG 299 Y P P P G P P P P GYPP PPP G YP A GYPP Y P G Sbjct: 53 YPPPPPPGGYPPPPQGGFPPPPPGGYPPPPPPQGGSYPPPPPPGAAGYPPPGYPGGPGAG 112 Query: 298 YPPSG 284 YPP+G Sbjct: 113 YPPAG 117 [161][TOP] >UniRef100_Q3E939 Uncharacterized protein At5g26080.1 n=1 Tax=Arabidopsis thaliana RepID=Q3E939_ARATH Length = 141 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/61 (44%), Positives = 30/61 (49%), Gaps = 6/61 (9%) Frame = -1 Query: 442 YAPQPAPYGQPA---PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAY---PPPGYPPSGY 281 Y+P P PY P P P Y +P +PP PP P YPP Y PPP YPP Y Sbjct: 40 YSPPPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIY 99 Query: 280 S 278 S Sbjct: 100 S 100 [162][TOP] >UniRef100_B9N0V9 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9N0V9_POPTR Length = 143 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/57 (47%), Positives = 30/57 (52%), Gaps = 4/57 (7%) Frame = -1 Query: 439 APQPAP-YGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYPP---AAYPPPGYPPSGY 281 +P P P Y AP P P+ PP PPP +GYP PP YPPPG PP GY Sbjct: 18 SPYPPPGYSPSAPPPPPHEGYPPPPPPPPPHEGYPPPPPPPPGYPGYPPPGPPPPGY 74 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/58 (48%), Positives = 29/58 (50%), Gaps = 5/58 (8%) Frame = -1 Query: 439 APQPAPYGQPAPQPAPYGQPYGYPPAPPP---AQGYPATGYPPAAYP--PPGYPPSGY 281 AP P P+ P P P GYPP PPP GYP G PP YP PP PP GY Sbjct: 29 APPPPPHEGYPPPPPPPPPHEGYPPPPPPPPGYPGYPPPGPPPPGYPGYPPPGPPRGY 86 [163][TOP] >UniRef100_B1Q483 C2 domain-containing protein n=1 Tax=Capsicum chinense RepID=B1Q483_CAPCH Length = 250 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/58 (46%), Positives = 29/58 (50%), Gaps = 8/58 (13%) Frame = -1 Query: 430 PAPYGQPAPQPAPYGQPYGYPPAPPPAQGYPATGYP-------PAAYPPP-GYPPSGY 281 P P+ P A Y P YP PP + YP T YP P AYPPP GYPPS Y Sbjct: 159 PPPHVASCPPAATYQTPSPYPAYPPHSAAYPPTSYPPPQPTAYPPAYPPPSGYPPSSY 216 [164][TOP] >UniRef100_A2FA50 Proline-rich protein MP-2-related protein n=1 Tax=Trichomonas vaginalis G3 RepID=A2FA50_TRIVA Length = 128 Score = 53.1 bits (126), Expect = 9e-06 Identities = 31/65 (47%), Positives = 32/65 (49%), Gaps = 12/65 (18%) Frame = -1 Query: 433 QPAPYGQPAPQPAPYGQPYGYPPAPPPAQGY----------PATGYPPAAY--PPPGYPP 290 QP PYG P P P P Q YG P PPP QGY YPP AY PPP PP Sbjct: 6 QPPPYGYP-PYPYPQPQAYGQQPPPPP-QGYGQQPPQNHYGAPPAYPPPAYGQPPPPPPP 63 Query: 289 SGYSR 275 GY + Sbjct: 64 QGYGQ 68 [165][TOP] >UniRef100_A8N3U3 Putative uncharacterized protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8N3U3_COPC7 Length = 554 Score = 53.1 bits (126), Expect = 9e-06 Identities = 31/57 (54%), Positives = 31/57 (54%), Gaps = 6/57 (10%) Frame = -1 Query: 436 PQPAPYGQPAPQPAPYGQPYG-YPPAPPPAQGYPATGYPPA----AYPP-PGYPPSG 284 P P QP P P G P G YPP P QGYP GYPPA AYP PGYPP G Sbjct: 24 PPPGAAPQPGQYPPPGGAPPGQYPPPPGAPQGYP--GYPPAQGYPAYPAYPGYPPPG 78