[UP]
[1][TOP] >UniRef100_C6TEJ8 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TEJ8_SOYBN Length = 270 Score = 55.5 bits (132), Expect(2) = 8e-15 Identities = 36/70 (51%), Positives = 38/70 (54%) Frame = -1 Query: 442 RTTEGPLIPGRMVGVLMTRGIRHLADL*VPDVMILLMKRGIGHLTDL*VLDAMIAVLQGP 263 RTT PL+ GRMVGVLMTR IRH AD P VL MIAVLQG Sbjct: 201 RTTRSPLVSGRMVGVLMTRRIRHPAD---PR-----------------VLGTMIAVLQGL 240 Query: 262 VRGHTVHADL 233 + G T HADL Sbjct: 241 IHGDTFHADL 250 Score = 48.5 bits (114), Expect(2) = 8e-15 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -3 Query: 521 DXRVRDDYYSPERSRSYSRSRSPSXGKDYR 432 D R RDDYYSPERSRSYSRS SPS G+ R Sbjct: 175 DGRGRDDYYSPERSRSYSRSLSPSGGRTTR 204 [2][TOP] >UniRef100_UPI0001984953 PREDICTED: similar to RNA recognition motif family protein, expressed n=1 Tax=Vitis vinifera RepID=UPI0001984953 Length = 287 Score = 74.7 bits (182), Expect = 4e-12 Identities = 57/119 (47%), Positives = 64/119 (53%), Gaps = 25/119 (21%) Frame = -3 Query: 521 DXRVRD----DYYSPERSRSYSRSRSPSXGKDYR---RSPHPRENGRSPNDKRD------ 381 D R RD DYYSP RSRS SRS SP K YR S PR+N +SP RD Sbjct: 170 DSRDRDRGGRDYYSPSRSRSVSRSVSPRDDKHYRSNHNSKSPRQNDQSPRSNRDRGSDKR 229 Query: 380 --------QAPSRSLSPRRDD--PPNEKRDRAPNRSVSPRRDDRSPSR--SRSRSYSPR 240 Q+P RS SPR +D +K + RS SPRR +RS SR SRSRSYSPR Sbjct: 230 SFSPMKNGQSP-RSPSPRENDRRKHGKKNQGSDRRSPSPRRYERSLSRSPSRSRSYSPR 287 [3][TOP] >UniRef100_A8JDG6 SR protein factor n=1 Tax=Chlamydomonas reinhardtii RepID=A8JDG6_CHLRE Length = 224 Score = 65.9 bits (159), Expect = 2e-09 Identities = 46/91 (50%), Positives = 52/91 (57%), Gaps = 7/91 (7%) Frame = -3 Query: 494 SPERSRSYS--RSRSPSXGKDYRRSPHP-RENGRSPNDKRDQAPSRSLSPRRDDPPNEKR 324 SP R RS S R RSPS + RRSP P R SP +R +P R SPRRD P E+R Sbjct: 133 SPPRRRSPSPLRRRSPSPLR--RRSPSPIRRRSPSPIRRRSPSPPRRSSPRRDSPVGERR 190 Query: 323 DRAPN----RSVSPRRDDRSPSRSRSRSYSP 243 R+P+ RS SP R P RSRSRS SP Sbjct: 191 PRSPSPIRERSASPPRRSPPPLRSRSRSRSP 221 [4][TOP] >UniRef100_C0SEU9 Pre-mRNA-splicing factor cwc22 n=1 Tax=Paracoccidioides brasiliensis Pb03 RepID=C0SEU9_PARBP Length = 1004 Score = 62.8 bits (151), Expect = 1e-08 Identities = 42/91 (46%), Positives = 48/91 (52%), Gaps = 5/91 (5%) Frame = -3 Query: 500 YYSPERSRSYSRSRSPSXGK--DYRRSPHPRENGRSPNDKRDQAPSRSLSPRRD---DPP 336 Y RSRSYSRSRSPS G+ RS P RSP R ++ RS +P R PP Sbjct: 654 YTGTSRSRSYSRSRSPSRGRRRSGSRSRSPSSMPRSPGTSRSRSRDRSYTPSRSRSRSPP 713 Query: 335 NEKRDRAPNRSVSPRRDDRSPSRSRSRSYSP 243 +R R P+ S SP R RSRS SYSP Sbjct: 714 TRRRGRQPSYSRSPSPASR---RSRSVSYSP 741 [5][TOP] >UniRef100_B9RSX1 Serine/arginine rich splicing factor, putative n=1 Tax=Ricinus communis RepID=B9RSX1_RICCO Length = 257 Score = 62.4 bits (150), Expect = 2e-08 Identities = 37/80 (46%), Positives = 47/80 (58%), Gaps = 3/80 (3%) Frame = -3 Query: 521 DXRVRDDYYSPERSRSYSRSRSPSXGKDYR---RSPHPRENGRSPNDKRDQAPSRSLSPR 351 D +DDY+SP RSRS SRSRSP +DYR RSP PREN +SP+ +R+ A SP Sbjct: 181 DRGAKDDYHSPRRSRSISRSRSPQDERDYRSNQRSPSPRENDQSPHAEREYASGGLGSPS 240 Query: 350 RDDPPNEKRDRAPNRSVSPR 291 + R R+ +RS R Sbjct: 241 GN---GHTRSRSRSRSNGSR 257 [6][TOP] >UniRef100_UPI0001983780 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001983780 Length = 891 Score = 62.0 bits (149), Expect = 3e-08 Identities = 46/86 (53%), Positives = 50/86 (58%), Gaps = 5/86 (5%) Frame = -3 Query: 494 SPERSRS-YSRSRSPSXGKDYRRSPHP-RENGRSPNDKRDQAPSRSLSPRRDDPPNEKRD 321 SP R RS YSR RS S + RSP P R RSP +R Q P R SPRR PP +R Sbjct: 258 SPSRRRSSYSRRRSTSVSR--HRSPSPMRRRLRSPGRRRSQTPVRRRSPRR-SPPGWRRS 314 Query: 320 RAP--NRSVSP-RRDDRSPSRSRSRS 252 R+P RS SP RR RSP R RSRS Sbjct: 315 RSPGRRRSRSPGRRRSRSPGRRRSRS 340 [7][TOP] >UniRef100_C5XPA0 Putative uncharacterized protein Sb03g005500 n=1 Tax=Sorghum bicolor RepID=C5XPA0_SORBI Length = 296 Score = 61.6 bits (148), Expect = 3e-08 Identities = 43/95 (45%), Positives = 48/95 (50%), Gaps = 10/95 (10%) Frame = -3 Query: 497 YSPERSRSYSRSRSPSXGKDYRRSPH-PRENGRSPNDKRDQAPSRSLSPRRDDPPNEKRD 321 YS RSR YSRSRSP RSP R RSP D R S SLS RD P+ Sbjct: 181 YSRSRSRGYSRSRSPRQNSRDERSPRDSRSPRRSPRDSRSPRRSPSLSKGRDRSPSPNGS 240 Query: 320 RAP--------NRSVSPRRDD-RSPSRSRSRSYSP 243 R+P + S+SPRRDD RSP+ R SP Sbjct: 241 RSPAPRERNGSDYSMSPRRDDSRSPADHLRREISP 275 [8][TOP] >UniRef100_C1H4D9 Pre-mRNA-splicing factor cwc22 n=1 Tax=Paracoccidioides brasiliensis Pb01 RepID=C1H4D9_PARBA Length = 867 Score = 61.2 bits (147), Expect = 4e-08 Identities = 46/93 (49%), Positives = 52/93 (55%), Gaps = 7/93 (7%) Frame = -3 Query: 500 YYSPERSRSYSRSRSPSXGK---DYRRSPH--PRENGRSPNDKRDQA--PSRSLSPRRDD 342 Y RSRSYSRSRSPS G+ + RSP PR G S + RD++ PSRS S R Sbjct: 654 YTGTSRSRSYSRSRSPSRGRRSGSFSRSPSSMPRSPGTSRSRSRDRSYTPSRSRS-RSRS 712 Query: 341 PPNEKRDRAPNRSVSPRRDDRSPSRSRSRSYSP 243 PP R R P+ S SP R RSRS SYSP Sbjct: 713 PPTRCRGRQPSYSRSPTPASR---RSRSVSYSP 742 [9][TOP] >UniRef100_UPI00018662E7 hypothetical protein BRAFLDRAFT_126505 n=1 Tax=Branchiostoma floridae RepID=UPI00018662E7 Length = 325 Score = 60.8 bits (146), Expect = 6e-08 Identities = 42/86 (48%), Positives = 51/86 (59%), Gaps = 2/86 (2%) Frame = -3 Query: 482 SRSYSRSRSPSXG-KDYRRSPHPRENGRSPNDKRDQAPSRSLSPRRDDPPNEKRDRAPNR 306 SRS SRSRSPS + Y RSP R RSP+ R ++ SRS SPR+ + R R+ + Sbjct: 32 SRSASRSRSPSGSNRSYSRSPSARAASRSPSRSRSRSASRSPSPRKHSRASRSRSRSRSY 91 Query: 305 SVSPRRDDRSPSRSRS-RSYSPR*SA 231 RR RS SRSRS R YSPR S+ Sbjct: 92 D-RRRRYSRSRSRSRSRRRYSPRRSS 116 [10][TOP] >UniRef100_B2AX37 Predicted CDS Pa_7_9220 n=1 Tax=Podospora anserina RepID=B2AX37_PODAN Length = 899 Score = 60.8 bits (146), Expect = 6e-08 Identities = 46/96 (47%), Positives = 53/96 (55%), Gaps = 6/96 (6%) Frame = -3 Query: 515 RVRDDYYSPERSRSYSRSRSPSXGKDYRRSPHP---RENGRSPNDKRDQAPSRSLSPRRD 345 R RDD YS RSRSYSRS SP + RSP P R + RS + R + SRS S R Sbjct: 783 RARDDSYSRSRSRSYSRSVSPR--RSISRSPPPRAGRRDSRSLSKDRSMSRSRSRSWSRS 840 Query: 344 DPPNEKR--DRAPNRSVS-PRRDDRSPSRSRSRSYS 246 PP + A +RS S P R RS SR+RS SYS Sbjct: 841 PPPRARSPVGNARDRSFSPPPRRGRSRSRTRSLSYS 876 [11][TOP] >UniRef100_UPI000059D73E serine/arginine repetitive matrix 5 n=1 Tax=Homo sapiens RepID=UPI000059D73E Length = 715 Score = 60.1 bits (144), Expect = 1e-07 Identities = 44/98 (44%), Positives = 58/98 (59%), Gaps = 14/98 (14%) Frame = -3 Query: 494 SPERSRSYSRSRSPSXGKDYRRSPHPR-ENGR----SPNDKRDQAPSRSLSPRRD----D 342 +P + RS+S SRS S +D+R S PR E+GR SPN +RD + SRS + RD Sbjct: 358 NPSKERSHSHSRSSSKERDHRGSSSPRKESGRSQSGSPNKQRDHSRSRSPNKARDRSRSR 417 Query: 341 PPNEKRDRAPNRSVSPRRD---DRSP--SRSRSRSYSP 243 P + RDR+ +RS + RD RSP +R RSRS SP Sbjct: 418 SPYKARDRSRSRSPNKARDCSRSRSPYKARDRSRSRSP 455 Score = 58.5 bits (140), Expect = 3e-07 Identities = 39/93 (41%), Positives = 49/93 (52%), Gaps = 12/93 (12%) Frame = -3 Query: 494 SPERSRSYSRSRSPSXGKDYRRSPHP-----RENGRSPNDKRDQAPSRSLSPRRD----D 342 SP + R +SRSRSP+ +D RS P R RSPN RD + SRS RD Sbjct: 394 SPNKQRDHSRSRSPNKARDRSRSRSPYKARDRSRSRSPNKARDCSRSRSPYKARDRSRSR 453 Query: 341 PPNEKRDRAPNRSVSPRRD---DRSPSRSRSRS 252 PN+ RD + +RS + RD RSPS+ R S Sbjct: 454 SPNKARDHSRSRSPNKARDRSRSRSPSKERDHS 486 Score = 57.4 bits (137), Expect = 6e-07 Identities = 43/101 (42%), Positives = 52/101 (51%), Gaps = 10/101 (9%) Frame = -3 Query: 515 RVRDDYYSPERSRSYSRSRSPSXGKDYRRSPHP-----RENGRSPNDKRDQAPSRSLSPR 351 R R SP ++R SRSRSP+ +D RS P R RSPN RD + SRS Sbjct: 411 RDRSRSRSPYKARDRSRSRSPNKARDCSRSRSPYKARDRSRSRSPNKARDHSRSRS---- 466 Query: 350 RDDPPNEKRDRAPNRSVSPRRDDR---SPSRSRS--RSYSP 243 PN+ RDR+ +RS S RD SPS+ R RS SP Sbjct: 467 ----PNKARDRSRSRSPSKERDHSQLGSPSKERDHRRSRSP 503 Score = 57.0 bits (136), Expect = 8e-07 Identities = 34/99 (34%), Positives = 53/99 (53%), Gaps = 12/99 (12%) Frame = -3 Query: 515 RVRDDYYSPERSRSYSRSRSPSXGKDYRRSPHP---------RENGRSPNDKRDQAPSRS 363 R R SP + R +S+ SPS +D+RRS P R + + + +R ++PS+ Sbjct: 471 RDRSRSRSPSKERDHSQLGSPSKERDHRRSRSPSKERQCRQSRSSSKERDHRRSRSPSKE 530 Query: 362 LSPRRDDPPNEKRDRAPNRSVSPRRD---DRSPSRSRSR 255 R+ PN++RDR+ +RS S R+ RSPS+ R R Sbjct: 531 RQRRQSRSPNKERDRSQSRSPSEEREHRQSRSPSKERDR 569 Score = 55.8 bits (133), Expect = 2e-06 Identities = 37/91 (40%), Positives = 49/91 (53%), Gaps = 8/91 (8%) Frame = -3 Query: 494 SPERSRSYSRSRSPSXGKDYRRSPHP-----RENGRSPNDKRDQAPSRSLSPRRDDPPNE 330 SP + R +SRS S +D+RRS P R RSPN +RD++ SRS P+E Sbjct: 502 SPSKERQCRQSRSSSKERDHRRSRSPSKERQRRQSRSPNKERDRSQSRS--------PSE 553 Query: 329 KRDRAPNRSVSPRRDDR---SPSRSRSRSYS 246 +R+ +RS S RD R SPS+ R R S Sbjct: 554 EREHRQSRSPSKERDRRRWRSPSKERERRQS 584 Score = 54.3 bits (129), Expect = 5e-06 Identities = 37/97 (38%), Positives = 51/97 (52%), Gaps = 7/97 (7%) Frame = -3 Query: 515 RVRDDYYSPERSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQ----APSRSLSPRR 348 R R SP ++R +SRSRSP+ +D RS RSP+ +RD +PS+ RR Sbjct: 447 RDRSRSRSPNKARDHSRSRSPNKARDRSRS-------RSPSKERDHSQLGSPSKERDHRR 499 Query: 347 DDPPNEKRDRAPNRSVSPRRD---DRSPSRSRSRSYS 246 P+++R +RS S RD RSPS+ R R S Sbjct: 500 SRSPSKERQCRQSRSSSKERDHRRSRSPSKERQRRQS 536 [12][TOP] >UniRef100_B9FUU5 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FUU5_ORYSJ Length = 338 Score = 60.1 bits (144), Expect = 1e-07 Identities = 40/90 (44%), Positives = 51/90 (56%) Frame = -3 Query: 512 VRDDYYSPERSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAPSRSLSPRRDDPPN 333 +R Y +RSRSYSRSRS S G+ Y RS PR RS + A + SP++ Sbjct: 245 IRVKEYDGKRSRSYSRSRSRSRGRSYSRSRSPRSPARSQSPNTSPANGDAASPKK----- 299 Query: 332 EKRDRAPNRSVSPRRDDRSPSRSRSRSYSP 243 R+P+RS P++ RSPSRS SRS SP Sbjct: 300 ----RSPSRS-PPKK--RSPSRSPSRSRSP 322 [13][TOP] >UniRef100_B8B5U9 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8B5U9_ORYSI Length = 321 Score = 60.1 bits (144), Expect = 1e-07 Identities = 40/90 (44%), Positives = 51/90 (56%) Frame = -3 Query: 512 VRDDYYSPERSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAPSRSLSPRRDDPPN 333 +R Y +RSRSYSRSRS S G+ Y RS PR RS + A + SP++ Sbjct: 228 IRVKEYDGKRSRSYSRSRSRSRGRSYSRSRSPRSPARSQSPNTSPANGDAASPKK----- 282 Query: 332 EKRDRAPNRSVSPRRDDRSPSRSRSRSYSP 243 R+P+RS P++ RSPSRS SRS SP Sbjct: 283 ----RSPSRS-PPKK--RSPSRSPSRSRSP 305 [14][TOP] >UniRef100_Q4G0Z0 LOC100170229 protein (Fragment) n=1 Tax=Homo sapiens RepID=Q4G0Z0_HUMAN Length = 603 Score = 60.1 bits (144), Expect = 1e-07 Identities = 44/98 (44%), Positives = 58/98 (59%), Gaps = 14/98 (14%) Frame = -3 Query: 494 SPERSRSYSRSRSPSXGKDYRRSPHPR-ENGR----SPNDKRDQAPSRSLSPRRD----D 342 +P + RS+S SRS S +D+R S PR E+GR SPN +RD + SRS + RD Sbjct: 366 NPSKERSHSHSRSSSKERDHRGSSSPRKESGRSQSGSPNKQRDHSRSRSPNKARDRSRSR 425 Query: 341 PPNEKRDRAPNRSVSPRRD---DRSP--SRSRSRSYSP 243 P + RDR+ +RS + RD RSP +R RSRS SP Sbjct: 426 SPYKARDRSRSRSPNKARDCSRSRSPYKARDRSRSRSP 463 Score = 57.4 bits (137), Expect = 6e-07 Identities = 38/91 (41%), Positives = 50/91 (54%), Gaps = 8/91 (8%) Frame = -3 Query: 494 SPERSRSYSRSRSPSXGKDYRRSPHP-----RENGRSPNDKRDQAPSRSLSPRRDDPPNE 330 SP + R +SRSRSP+ +D RS P R RSPN RD + SRS P + Sbjct: 402 SPNKQRDHSRSRSPNKARDRSRSRSPYKARDRSRSRSPNKARDCSRSRS--------PYK 453 Query: 329 KRDRAPNRSVSPRRD---DRSPSRSRSRSYS 246 RDR+ +RS + RD RSP+++R RS S Sbjct: 454 ARDRSRSRSPNKARDHSRSRSPNKARDRSRS 484 Score = 54.7 bits (130), Expect = 4e-06 Identities = 38/98 (38%), Positives = 49/98 (50%), Gaps = 8/98 (8%) Frame = -3 Query: 515 RVRDDYYSPERSRSYSRSRSPSXGKDYRRSPHP-----RENGRSPNDKRDQAPSRSLSPR 351 R R SP ++R SRSRSP+ +D RS P R RSPN RD + SRS + Sbjct: 419 RDRSRSRSPYKARDRSRSRSPNKARDCSRSRSPYKARDRSRSRSPNKARDHSRSRSPNKA 478 Query: 350 RDDPPNEKRDRAPNRSVS---PRRDDRSPSRSRSRSYS 246 RD R R+PN+ PR + + SRSR+ S Sbjct: 479 RD----RSRSRSPNKQSGYSRPRASSKEKAHSRSRTPS 512 [15][TOP] >UniRef100_B4DNF0 cDNA FLJ56397, weakly similar to Mus musculus serine/arginine repetitive matrix 2 (Srrm2), mRNA n=1 Tax=Homo sapiens RepID=B4DNF0_HUMAN Length = 730 Score = 60.1 bits (144), Expect = 1e-07 Identities = 39/93 (41%), Positives = 50/93 (53%), Gaps = 12/93 (12%) Frame = -3 Query: 494 SPERSRSYSRSRSPSXGKDYRRSPHP-----RENGRSPNDKRDQAPSRSLSPRRD----D 342 SP + R +SRSRSP+ +D RS P R RSPN RD++ SRS RD Sbjct: 409 SPNKQRDHSRSRSPNKARDRSRSRSPYKARDRSRSRSPNKARDRSRSRSPYKARDRSRSR 468 Query: 341 PPNEKRDRAPNRSVSPRRD---DRSPSRSRSRS 252 PN+ RD + +RS + RD RSPS+ R S Sbjct: 469 SPNKARDHSRSRSPNKARDRSRSRSPSKERDHS 501 Score = 58.5 bits (140), Expect = 3e-07 Identities = 44/98 (44%), Positives = 57/98 (58%), Gaps = 14/98 (14%) Frame = -3 Query: 494 SPERSRSYSRSRSPSXGKDYRRSPHPR-ENGR----SPNDKRDQAPSRSLSPRRD----D 342 +P + RS+S SRS S D+R S PR E+GR SPN +RD + SRS + RD Sbjct: 373 NPSKERSHSHSRSSSKEGDHRGSSSPRKESGRSQSGSPNKQRDHSRSRSPNKARDRSRSR 432 Query: 341 PPNEKRDRAPNRSVSPRRD---DRSP--SRSRSRSYSP 243 P + RDR+ +RS + RD RSP +R RSRS SP Sbjct: 433 SPYKARDRSRSRSPNKARDRSRSRSPYKARDRSRSRSP 470 Score = 57.8 bits (138), Expect = 5e-07 Identities = 39/102 (38%), Positives = 53/102 (51%), Gaps = 12/102 (11%) Frame = -3 Query: 515 RVRDDYYSPERSRSYSRSRSPSXGKDYRRSPHP-----RENGRSPNDKRDQ----APSRS 363 R R SP ++R SRSRSP+ +D+ RS P R RSP+ +RD +PS+ Sbjct: 450 RDRSRSRSPYKARDRSRSRSPNKARDHSRSRSPNKARDRSRSRSPSKERDHSQLGSPSKE 509 Query: 362 LSPRRDDPPNEKRDRAPNRSVSPRRD---DRSPSRSRSRSYS 246 RR P+++R +RS S RD RSPS+ R R S Sbjct: 510 RDHRRSRSPSKERQCRQSRSSSKERDHRRSRSPSKERQRRQS 551 Score = 57.4 bits (137), Expect = 6e-07 Identities = 43/101 (42%), Positives = 52/101 (51%), Gaps = 10/101 (9%) Frame = -3 Query: 515 RVRDDYYSPERSRSYSRSRSPSXGKDYRRSPHP-----RENGRSPNDKRDQAPSRSLSPR 351 R R SP ++R SRSRSP+ +D RS P R RSPN RD + SRS Sbjct: 426 RDRSRSRSPYKARDRSRSRSPNKARDRSRSRSPYKARDRSRSRSPNKARDHSRSRS---- 481 Query: 350 RDDPPNEKRDRAPNRSVSPRRDDR---SPSRSRS--RSYSP 243 PN+ RDR+ +RS S RD SPS+ R RS SP Sbjct: 482 ----PNKARDRSRSRSPSKERDHSQLGSPSKERDHRRSRSP 518 Score = 57.0 bits (136), Expect = 8e-07 Identities = 34/99 (34%), Positives = 53/99 (53%), Gaps = 12/99 (12%) Frame = -3 Query: 515 RVRDDYYSPERSRSYSRSRSPSXGKDYRRSPHP---------RENGRSPNDKRDQAPSRS 363 R R SP + R +S+ SPS +D+RRS P R + + + +R ++PS+ Sbjct: 486 RDRSRSRSPSKERDHSQLGSPSKERDHRRSRSPSKERQCRQSRSSSKERDHRRSRSPSKE 545 Query: 362 LSPRRDDPPNEKRDRAPNRSVSPRRD---DRSPSRSRSR 255 R+ PN++RDR+ +RS S R+ RSPS+ R R Sbjct: 546 RQRRQSRSPNKERDRSQSRSPSEEREHRQSRSPSKERDR 584 Score = 55.8 bits (133), Expect = 2e-06 Identities = 37/91 (40%), Positives = 49/91 (53%), Gaps = 8/91 (8%) Frame = -3 Query: 494 SPERSRSYSRSRSPSXGKDYRRSPHP-----RENGRSPNDKRDQAPSRSLSPRRDDPPNE 330 SP + R +SRS S +D+RRS P R RSPN +RD++ SRS P+E Sbjct: 517 SPSKERQCRQSRSSSKERDHRRSRSPSKERQRRQSRSPNKERDRSQSRS--------PSE 568 Query: 329 KRDRAPNRSVSPRRDDR---SPSRSRSRSYS 246 +R+ +RS S RD R SPS+ R R S Sbjct: 569 EREHRQSRSPSKERDRRRWRSPSKERERRQS 599 [16][TOP] >UniRef100_B3KS81 cDNA FLJ35737 fis, clone TESTI2003579, weakly similar to Mus musculus serine/arginine repetitive matrix 2 (Srrm2), mRNA n=1 Tax=Homo sapiens RepID=B3KS81_HUMAN Length = 715 Score = 60.1 bits (144), Expect = 1e-07 Identities = 44/98 (44%), Positives = 58/98 (59%), Gaps = 14/98 (14%) Frame = -3 Query: 494 SPERSRSYSRSRSPSXGKDYRRSPHPR-ENGR----SPNDKRDQAPSRSLSPRRD----D 342 +P + RS+S SRS S +D+R S PR E+GR SPN +RD + SRS + RD Sbjct: 358 NPSKERSHSHSRSSSKERDHRGSSSPRKESGRSQSGSPNKQRDHSRSRSPNKARDRSRSR 417 Query: 341 PPNEKRDRAPNRSVSPRRD---DRSP--SRSRSRSYSP 243 P + RDR+ +RS + RD RSP +R RSRS SP Sbjct: 418 SPYKARDRSRSRSPNKARDCSRSRSPYKARDRSRSRSP 455 Score = 58.5 bits (140), Expect = 3e-07 Identities = 39/93 (41%), Positives = 49/93 (52%), Gaps = 12/93 (12%) Frame = -3 Query: 494 SPERSRSYSRSRSPSXGKDYRRSPHP-----RENGRSPNDKRDQAPSRSLSPRRD----D 342 SP + R +SRSRSP+ +D RS P R RSPN RD + SRS RD Sbjct: 394 SPNKQRDHSRSRSPNKARDRSRSRSPYKARDRSRSRSPNKARDCSRSRSPYKARDRSRSR 453 Query: 341 PPNEKRDRAPNRSVSPRRD---DRSPSRSRSRS 252 PN+ RD + +RS + RD RSPS+ R S Sbjct: 454 SPNKARDHSRSRSPNKARDRSRSRSPSKERDHS 486 Score = 57.4 bits (137), Expect = 6e-07 Identities = 43/101 (42%), Positives = 52/101 (51%), Gaps = 10/101 (9%) Frame = -3 Query: 515 RVRDDYYSPERSRSYSRSRSPSXGKDYRRSPHP-----RENGRSPNDKRDQAPSRSLSPR 351 R R SP ++R SRSRSP+ +D RS P R RSPN RD + SRS Sbjct: 411 RDRSRSRSPYKARDRSRSRSPNKARDCSRSRSPYKARDRSRSRSPNKARDHSRSRS---- 466 Query: 350 RDDPPNEKRDRAPNRSVSPRRDDR---SPSRSRS--RSYSP 243 PN+ RDR+ +RS S RD SPS+ R RS SP Sbjct: 467 ----PNKARDRSRSRSPSKERDHSQLGSPSKERDHRRSRSP 503 Score = 57.0 bits (136), Expect = 8e-07 Identities = 34/99 (34%), Positives = 53/99 (53%), Gaps = 12/99 (12%) Frame = -3 Query: 515 RVRDDYYSPERSRSYSRSRSPSXGKDYRRSPHP---------RENGRSPNDKRDQAPSRS 363 R R SP + R +S+ SPS +D+RRS P R + + + +R ++PS+ Sbjct: 471 RDRSRSRSPSKERDHSQLGSPSKERDHRRSRSPSKERQCRQSRSSSKERDHRRSRSPSKE 530 Query: 362 LSPRRDDPPNEKRDRAPNRSVSPRRD---DRSPSRSRSR 255 R+ PN++RDR+ +RS S R+ RSPS+ R R Sbjct: 531 RQRRQSRSPNKERDRSQSRSPSEEREHRQSRSPSKERDR 569 Score = 55.8 bits (133), Expect = 2e-06 Identities = 37/91 (40%), Positives = 49/91 (53%), Gaps = 8/91 (8%) Frame = -3 Query: 494 SPERSRSYSRSRSPSXGKDYRRSPHP-----RENGRSPNDKRDQAPSRSLSPRRDDPPNE 330 SP + R +SRS S +D+RRS P R RSPN +RD++ SRS P+E Sbjct: 502 SPSKERQCRQSRSSSKERDHRRSRSPSKERQRRQSRSPNKERDRSQSRS--------PSE 553 Query: 329 KRDRAPNRSVSPRRDDR---SPSRSRSRSYS 246 +R+ +RS S RD R SPS+ R R S Sbjct: 554 EREHRQSRSPSKERDRRRWRSPSKERERRQS 584 Score = 54.3 bits (129), Expect = 5e-06 Identities = 37/97 (38%), Positives = 51/97 (52%), Gaps = 7/97 (7%) Frame = -3 Query: 515 RVRDDYYSPERSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQ----APSRSLSPRR 348 R R SP ++R +SRSRSP+ +D RS RSP+ +RD +PS+ RR Sbjct: 447 RDRSRSRSPNKARDHSRSRSPNKARDRSRS-------RSPSKERDHSQLGSPSKERDHRR 499 Query: 347 DDPPNEKRDRAPNRSVSPRRD---DRSPSRSRSRSYS 246 P+++R +RS S RD RSPS+ R R S Sbjct: 500 SRSPSKERQCRQSRSSSKERDHRRSRSPSKERQRRQS 536 [17][TOP] >UniRef100_Q9SEU4 At1g55310 n=1 Tax=Arabidopsis thaliana RepID=Q9SEU4_ARATH Length = 287 Score = 59.7 bits (143), Expect = 1e-07 Identities = 46/103 (44%), Positives = 54/103 (52%), Gaps = 16/103 (15%) Frame = -3 Query: 503 DYYSPERSRSYSRSRSP-----SXGKDYRRSP-HPRENGRSPNDKRDQAPSRSLSPRRDD 342 DYYSP R + RS SP + Y RSP GRS R ++ S S SPRR Sbjct: 162 DYYSPPPRRHHPRSISPREERYDGRRSYSRSPASDGSRGRSLTPVRGKSRSLSPSPRRSI 221 Query: 341 PPNEKRDRAP----NRSVSPRRD-DRSPSRSRS-----RSYSP 243 + +R R+P NRSVSPRR RSP RSRS RSY+P Sbjct: 222 SRSPRRSRSPSPKRNRSVSPRRSISRSPRRSRSPRRSRRSYTP 264 Score = 53.5 bits (127), Expect = 9e-06 Identities = 36/87 (41%), Positives = 46/87 (52%), Gaps = 3/87 (3%) Frame = -3 Query: 494 SPERSRSYSRSRSPSXGKDYRRSPHPREN-GRSPNDKRDQAP--SRSLSPRRDDPPNEKR 324 SP S RS +P GK SP PR + RSP R +P +RS+SPRR + +R Sbjct: 192 SPASDGSRGRSLTPVRGKSRSLSPSPRRSISRSPRRSRSPSPKRNRSVSPRRSISRSPRR 251 Query: 323 DRAPNRSVSPRRDDRSPSRSRSRSYSP 243 R+P RS R +P +RSRS SP Sbjct: 252 SRSPRRS----RRSYTPEPARSRSQSP 274 [18][TOP] >UniRef100_C0Z312 AT1G55310 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z312_ARATH Length = 203 Score = 59.7 bits (143), Expect = 1e-07 Identities = 46/103 (44%), Positives = 54/103 (52%), Gaps = 16/103 (15%) Frame = -3 Query: 503 DYYSPERSRSYSRSRSP-----SXGKDYRRSP-HPRENGRSPNDKRDQAPSRSLSPRRDD 342 DYYSP R + RS SP + Y RSP GRS R ++ S S SPRR Sbjct: 78 DYYSPPPRRHHPRSISPREERYDGRRSYSRSPASDGSRGRSLTPVRGKSRSLSPSPRRSI 137 Query: 341 PPNEKRDRAP----NRSVSPRRD-DRSPSRSRS-----RSYSP 243 + +R R+P NRSVSPRR RSP RSRS RSY+P Sbjct: 138 SRSPRRSRSPSPKRNRSVSPRRSISRSPRRSRSPRRSRRSYTP 180 Score = 53.5 bits (127), Expect = 9e-06 Identities = 36/87 (41%), Positives = 46/87 (52%), Gaps = 3/87 (3%) Frame = -3 Query: 494 SPERSRSYSRSRSPSXGKDYRRSPHPREN-GRSPNDKRDQAP--SRSLSPRRDDPPNEKR 324 SP S RS +P GK SP PR + RSP R +P +RS+SPRR + +R Sbjct: 108 SPASDGSRGRSLTPVRGKSRSLSPSPRRSISRSPRRSRSPSPKRNRSVSPRRSISRSPRR 167 Query: 323 DRAPNRSVSPRRDDRSPSRSRSRSYSP 243 R+P RS R +P +RSRS SP Sbjct: 168 SRSPRRS----RRSYTPEPARSRSQSP 190 [19][TOP] >UniRef100_Q5ZCD9 Os01g0155600 protein n=3 Tax=Oryza sativa RepID=Q5ZCD9_ORYSJ Length = 324 Score = 59.7 bits (143), Expect = 1e-07 Identities = 45/96 (46%), Positives = 52/96 (54%), Gaps = 6/96 (6%) Frame = -3 Query: 509 RDDYYSPE---RSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAPSRSLSPRRDDP 339 RD SP+ R RSYSRS SP G R GRS + R ++ SRS SPRRD Sbjct: 144 RDCRNSPKNLKRGRSYSRSPSPRRG---------RSRGRSYSRSRSRSYSRSQSPRRDS- 193 Query: 338 PNEKRDRAPNRSVSPR---RDDRSPSRSRSRSYSPR 240 NE+R R+P S SPR RD RSP S S SP+ Sbjct: 194 RNERRSRSPRDSRSPRGSPRDSRSPRGSPRDSRSPK 229 Score = 54.7 bits (130), Expect = 4e-06 Identities = 46/105 (43%), Positives = 58/105 (55%), Gaps = 13/105 (12%) Frame = -3 Query: 515 RVRDDYYSPERSRSYSRSRSP-SXGKDYRRSPHPRENGR---SPNDKRDQ--APSRSLSP 354 R R YS RSRSYSRS+SP ++ RRS PR++ SP D R +P S SP Sbjct: 169 RSRGRSYSRSRSRSYSRSQSPRRDSRNERRSRSPRDSRSPRGSPRDSRSPRGSPRDSRSP 228 Query: 353 R---RD--DPPNEKRD-RAPNRSVSPRRD-DRSPSRSRSRSYSPR 240 + RD P RD R+P RS SP +RSP+ + SRS +PR Sbjct: 229 KGSPRDTQSPRGSPRDSRSPRRSASPPNGRNRSPTPNASRSPAPR 273 Score = 54.3 bits (129), Expect = 5e-06 Identities = 37/91 (40%), Positives = 47/91 (51%), Gaps = 3/91 (3%) Frame = -3 Query: 494 SPERSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAPSRSLSPRRDDPPNEKRDRA 315 SP R RS RS S S + Y RS PR + R N++R ++P S SPR + + Sbjct: 164 SPRRGRSRGRSYSRSRSRSYSRSQSPRRDSR--NERRSRSPRDSRSPRGSPRDSRSPRGS 221 Query: 314 PNRSVSPR---RDDRSPSRSRSRSYSPR*SA 231 P S SP+ RD +SP S S SPR SA Sbjct: 222 PRDSRSPKGSPRDTQSPRGSPRDSRSPRRSA 252 [20][TOP] >UniRef100_Q09511 Probable splicing factor, arginine/serine-rich 4 n=1 Tax=Caenorhabditis elegans RepID=RSP4_CAEEL Length = 196 Score = 58.9 bits (141), Expect = 2e-07 Identities = 39/80 (48%), Positives = 45/80 (56%), Gaps = 2/80 (2%) Frame = -3 Query: 485 RSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAPSRSLS--PRRDDPPNEKRDRAP 312 RS YSRSRSP + RSP R+ SP D+RD + SRS S PR D P E+R R+ Sbjct: 124 RSPRYSRSRSPRRSRSRTRSPPSRDRRDSP-DRRDNSRSRSRSPPPREDGSPKERRSRS- 181 Query: 311 NRSVSPRRDDRSPSRSRSRS 252 R RSPSRSRS S Sbjct: 182 ------RSASRSPSRSRSNS 195 [21][TOP] >UniRef100_UPI0000122657 Hypothetical protein CBG02383 n=1 Tax=Caenorhabditis briggsae AF16 RepID=UPI0000122657 Length = 195 Score = 58.5 bits (140), Expect = 3e-07 Identities = 37/78 (47%), Positives = 44/78 (56%) Frame = -3 Query: 485 RSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAPSRSLSPRRDDPPNEKRDRAPNR 306 RS YSRSRSP + RSP R+ SP D+RD++ SRS SP PP + A +R Sbjct: 122 RSPRYSRSRSPRRSRSRTRSPPSRDRRDSP-DRRDRSASRSRSP----PPRDDASPARDR 176 Query: 305 SVSPRRDDRSPSRSRSRS 252 R RSPSRSRS S Sbjct: 177 RSRSRSASRSPSRSRSHS 194 [22][TOP] >UniRef100_UPI000058483A PREDICTED: hypothetical protein n=1 Tax=Strongylocentrotus purpuratus RepID=UPI000058483A Length = 341 Score = 57.8 bits (138), Expect = 5e-07 Identities = 40/91 (43%), Positives = 51/91 (56%), Gaps = 6/91 (6%) Frame = -3 Query: 494 SPERSRSYSRSRSPSXGKDYRRSP-HPRENGRSPNDKRDQAPSRSLSPRRDDPPNEKRDR 318 S R + SRSRSP + RSP R RSP KR ++ SRS RRD + R R Sbjct: 107 SRSRDKRRSRSRSPLRKRSRSRSPLRKRTRSRSPLRKRTRSRSRSSRRRRDSHMSRTRSR 166 Query: 317 APNR----SVSPRRD-DRSPSRSRSRSYSPR 240 +P+R S SPRR R+P +SRSR+ +PR Sbjct: 167 SPHRSRDKSRSPRRSRTRTPRKSRSRTRTPR 197 [23][TOP] >UniRef100_Q677R0 Putative uncharacterized protein n=1 Tax=Lymphocystis disease virus - isolate China RepID=Q677R0_9VIRU Length = 149 Score = 57.8 bits (138), Expect = 5e-07 Identities = 40/93 (43%), Positives = 54/93 (58%), Gaps = 7/93 (7%) Frame = -3 Query: 509 RDDY---YSPERSRSYSRSRSPSXGKDYRR---SPHPRENGRSPNDKRDQAPS-RSLSPR 351 R DY Y P + +S+SPS GK +R SPH RS + +R ++PS RS SPR Sbjct: 30 RADYLTAYCPVPKKPGRKSKSPSPGKKSKRRSKSPH-----RSKSPRRSKSPSKRSKSPR 84 Query: 350 RDDPPNEKRDRAPNRSVSPRRDDRSPSRSRSRS 252 R P+ KR ++P RS SP + +SP RS+S S Sbjct: 85 RSKSPS-KRSKSPRRSKSPSKRSKSPRRSKSPS 116 [24][TOP] >UniRef100_O82021 Putative arginine/serine-rich splicing factor n=1 Tax=Medicago sativa RepID=O82021_MEDSA Length = 286 Score = 57.8 bits (138), Expect = 5e-07 Identities = 45/100 (45%), Positives = 57/100 (57%), Gaps = 8/100 (8%) Frame = -3 Query: 515 RVRDDYYSPERSRSYSRS---RSPSXGKDY-RRSPHPRENGRSPNDKRDQAPSRSLSPRR 348 R R + RSRS SRS RSP +RSP PR RSP+ KR +P RS SP+R Sbjct: 175 RGRGRHDDERRSRSRSRSVDSRSPVRRSSIPKRSPSPR---RSPSPKRSPSPKRSPSPKR 231 Query: 347 DDPPNEKRDRAPNRSVSPRRD---DRSPSRSR-SRSYSPR 240 P+ KR +P +SVSPR+ + SRSR RS++PR Sbjct: 232 S--PSLKRSISPQKSVSPRKSPLRESPDSRSRGGRSFTPR 269 [25][TOP] >UniRef100_A9PDA2 Putative uncharacterized protein n=1 Tax=Populus trichocarpa RepID=A9PDA2_POPTR Length = 252 Score = 57.8 bits (138), Expect = 5e-07 Identities = 37/94 (39%), Positives = 47/94 (50%) Frame = -3 Query: 521 DXRVRDDYYSPERSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAPSRSLSPRRDD 342 D V++DY SP RSRS SRSRSP +D+ Q RSLSP Sbjct: 177 DRGVKEDYCSPRRSRSISRSRSPRDERDF------------------QVDQRSLSPSEKG 218 Query: 341 PPNEKRDRAPNRSVSPRRDDRSPSRSRSRSYSPR 240 ++R+ A S + R + RSPSRS S+SY R Sbjct: 219 RNPKERNHASRGSRTLRANSRSPSRSHSQSYGSR 252 [26][TOP] >UniRef100_C3YC21 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae RepID=C3YC21_BRAFL Length = 560 Score = 57.8 bits (138), Expect = 5e-07 Identities = 40/90 (44%), Positives = 49/90 (54%), Gaps = 6/90 (6%) Frame = -3 Query: 482 SRSYSRSRSPSXG-KDYRRSPHPRENGRSPNDKRDQAPSRSLSPRRDDPPNEKRDRAPN- 309 SRS SRSRSPS + Y RSP R RSP+ R ++ SRS SPR+ + R R+ + Sbjct: 32 SRSASRSRSPSGSNRSYSRSPSARAASRSPSRSRSRSASRSPSPRKHSRASRSRSRSRSY 91 Query: 308 ----RSVSPRRDDRSPSRSRSRSYSPR*SA 231 R R RS R RSRS SPR S+ Sbjct: 92 DRRRRYSRSRSRSRSRRRYRSRSRSPRRSS 121 [27][TOP] >UniRef100_C1GJX7 Putative uncharacterized protein n=1 Tax=Paracoccidioides brasiliensis Pb18 RepID=C1GJX7_PARBD Length = 623 Score = 57.8 bits (138), Expect = 5e-07 Identities = 36/91 (39%), Positives = 53/91 (58%), Gaps = 1/91 (1%) Frame = -3 Query: 509 RDDYYSPERSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAPSRSLSPRRDDPPNE 330 +D + S RSRS SRSRS S D R+ ++ S + +R ++P S+SPRR+ + Sbjct: 341 QDRFGSRNRSRSRSRSRSRSRSYDTRKRRRYSDSISSDDRERSKSPGSSISPRRNRSRSH 400 Query: 329 KRDRAPNRS-VSPRRDDRSPSRSRSRSYSPR 240 R + +RS +PRR S +RS+SYSPR Sbjct: 401 SRSISRSRSRTAPRRAGHRRSGTRSKSYSPR 431 [28][TOP] >UniRef100_UPI000180CD30 PREDICTED: similar to CDKN1A interacting zinc finger protein 1 n=1 Tax=Ciona intestinalis RepID=UPI000180CD30 Length = 753 Score = 57.4 bits (137), Expect = 6e-07 Identities = 45/110 (40%), Positives = 61/110 (55%), Gaps = 22/110 (20%) Frame = -3 Query: 503 DYY---SPERS---RSYSRSRSPSXGKDYRRSPHPRENGRSPNDK------------RDQ 378 +YY SP R+ RS+S +R+PS D++RS PR N RS N + R++ Sbjct: 97 EYYRGRSPPRNIPPRSHSPNRAPSP--DHKRSNSPR-NDRSTNQRVPSPRQERPASPRER 153 Query: 377 APSRSLSPRRDDPPNEKRDRAPN----RSVSPRRDDRSPSRSRSRSYSPR 240 P R SPRR+ PP+ +R+R P+ R SPRR +R PS R R SPR Sbjct: 154 MPPRPPSPRRERPPSPRRERPPSPRRERPPSPRR-ERPPSPRRERPPSPR 202 [29][TOP] >UniRef100_Q6AZT1 MGC81677 protein n=1 Tax=Xenopus laevis RepID=Q6AZT1_XENLA Length = 234 Score = 57.4 bits (137), Expect = 6e-07 Identities = 41/103 (39%), Positives = 48/103 (46%), Gaps = 12/103 (11%) Frame = -3 Query: 515 RVRDDYYSPERSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAP------------ 372 R R +S R R YSRSRS S G+ R + R SP R P Sbjct: 129 RTRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSASPRRSRSATPRRSRSGSVKRSR 188 Query: 371 SRSLSPRRDDPPNEKRDRAPNRSVSPRRDDRSPSRSRSRSYSP 243 SRS S R + R R+ +RS SP+R RSPSRS RS SP Sbjct: 189 SRSRSRSRSRSMSHPRSRSKSRSASPKR-SRSPSRSPRRSLSP 230 Score = 54.3 bits (129), Expect = 5e-06 Identities = 38/88 (43%), Positives = 47/88 (53%), Gaps = 3/88 (3%) Frame = -3 Query: 494 SPERSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAP--SRSLSPRRDDPPNEKRD 321 S RSRS+SRSR + RS R SP R +P SRS +PRR + KR Sbjct: 128 SRTRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSASPRRSRSATPRRSRSGSVKRS 187 Query: 320 RAPNRSVSPRRDDRSP-SRSRSRSYSPR 240 R+ +RS S R P SRS+SRS SP+ Sbjct: 188 RSRSRSRSRSRSMSHPRSRSKSRSASPK 215 [30][TOP] >UniRef100_B6D5W8 Polyhedral envelope protein n=1 Tax=Agrotis ipsilon multiple nucleopolyhedrovirus RepID=B6D5W8_9ABAC Length = 377 Score = 57.4 bits (137), Expect = 6e-07 Identities = 41/85 (48%), Positives = 48/85 (56%) Frame = -3 Query: 494 SPERSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAPSRSLSPRRDDPPNEKRDRA 315 SP R R RSPS RRS PR RS + R ++ RS+SPRR R R+ Sbjct: 118 SPRRRSPSPRRRSPSPR---RRSLSPRRRHRSRSRCRSRSRRRSVSPRRG-----SRSRS 169 Query: 314 PNRSVSPRRDDRSPSRSRSRSYSPR 240 +RSVSPRR SP R RSRS+SPR Sbjct: 170 RHRSVSPRRRSLSP-RRRSRSHSPR 193 [31][TOP] >UniRef100_C1BV13 Splicing factor, arginine/serine-rich 10 n=1 Tax=Lepeophtheirus salmonis RepID=C1BV13_9MAXI Length = 323 Score = 57.4 bits (137), Expect = 6e-07 Identities = 37/81 (45%), Positives = 48/81 (59%), Gaps = 2/81 (2%) Frame = -3 Query: 488 ERSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAPSRSLS--PRRDDPPNEKRDRA 315 +R RS SRSR S + R S PR+ SP K ++P R +S PRRD + R+ Sbjct: 47 DRGRSRSRSRK-SRSPNGRESRSPRKASMSPLRKDSRSPVRKMSRSPRRDSRSPRRNSRS 105 Query: 314 PNRSVSPRRDDRSPSRSRSRS 252 P RS SPR+D+R PSR +SRS Sbjct: 106 PRRSRSPRKDNR-PSRRKSRS 125 [32][TOP] >UniRef100_Q0D3Q1 Os07g0673500 protein n=2 Tax=Oryza sativa Japonica Group RepID=Q0D3Q1_ORYSJ Length = 296 Score = 57.0 bits (136), Expect = 8e-07 Identities = 41/113 (36%), Positives = 52/113 (46%), Gaps = 23/113 (20%) Frame = -3 Query: 512 VRDDYYSPERSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAPSRSLSP---RRDD 342 +R Y +RSRSYSRSRS S G+ Y RS P ++ + + +R + SRS S R + Sbjct: 179 IRVKEYDGKRSRSYSRSRSRSRGRSYSRSRSPSKSPKGKSSRRSASRSRSRSASSRSRSE 238 Query: 341 PPNEKRDRAPNRSVSPRRD--------------------DRSPSRSRSRSYSP 243 R+P RS SP RSPSRS SRS SP Sbjct: 239 SKGRSPSRSPARSQSPNTSPANGDAASPKKRSPSRSPPKKRSPSRSPSRSRSP 291 [33][TOP] >UniRef100_A6MZR5 Pre mRNA splicing factor sf2 (Fragment) n=1 Tax=Oryza sativa Indica Group RepID=A6MZR5_ORYSI Length = 154 Score = 57.0 bits (136), Expect = 8e-07 Identities = 41/113 (36%), Positives = 52/113 (46%), Gaps = 23/113 (20%) Frame = -3 Query: 512 VRDDYYSPERSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAPSRSLSP---RRDD 342 +R Y +RSRSYSRSRS S G+ Y RS P ++ + + +R + SRS S R + Sbjct: 37 IRVKEYDGKRSRSYSRSRSRSRGRSYSRSRSPSKSPKGKSSRRSASRSRSRSASSRSRSE 96 Query: 341 PPNEKRDRAPNRSVSPRRD--------------------DRSPSRSRSRSYSP 243 R+P RS SP RSPSRS SRS SP Sbjct: 97 SKGRSPSRSPARSQSPNTSPANGDAASPKKRSPSRSPPKKRSPSRSPSRSRSP 149 [34][TOP] >UniRef100_Q7PPE6 AGAP004592-PA n=1 Tax=Anopheles gambiae RepID=Q7PPE6_ANOGA Length = 342 Score = 57.0 bits (136), Expect = 8e-07 Identities = 41/95 (43%), Positives = 53/95 (55%), Gaps = 10/95 (10%) Frame = -3 Query: 494 SPERSRSYSRSRSPSXGKDYRRSPHPRENG-RSPNDKRDQA-----PSRSLSPRRDDPPN 333 S RSRS SRSR S + RS +NG +SP R ++ SRS SP+RD + Sbjct: 209 SRRRSRSRSRSRRSSRSRSKSRSRSKSKNGSKSPEKSRSRSRSVKSKSRSRSPKRDRDES 268 Query: 332 EKRDR----APNRSVSPRRDDRSPSRSRSRSYSPR 240 R R + +RS S +D++S SRSRSRS SPR Sbjct: 269 RSRSRSRSKSHSRSRSKSKDNKSRSRSRSRSRSPR 303 [35][TOP] >UniRef100_Q2QKC1 Alternative splicing regulator n=1 Tax=Triticum aestivum RepID=Q2QKC1_WHEAT Length = 333 Score = 56.6 bits (135), Expect = 1e-06 Identities = 40/95 (42%), Positives = 49/95 (51%), Gaps = 4/95 (4%) Frame = -3 Query: 515 RVRDDYYSPERSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAPSRSLSP---RRD 345 R R YS RSRSYSRSRS S + R R+ RS + ++P RSLSP D Sbjct: 164 RARSRSYS--RSRSYSRSRSRSYSESPRGRRTERDERRSRSISYSRSPRRSLSPGGKEMD 221 Query: 344 DPPNEKRDRAPNRSVSP-RRDDRSPSRSRSRSYSP 243 P R R+P RS+SP +D+ R R S SP Sbjct: 222 RSPTPDRSRSPRRSISPVAKDNGDSPRGRETSRSP 256 [36][TOP] >UniRef100_B9HSA1 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HSA1_POPTR Length = 252 Score = 56.6 bits (135), Expect = 1e-06 Identities = 36/91 (39%), Positives = 46/91 (50%) Frame = -3 Query: 512 VRDDYYSPERSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAPSRSLSPRRDDPPN 333 V++DY SP RSRS SRSRSP +D+ Q RSLSP Sbjct: 180 VKEDYCSPRRSRSISRSRSPRDERDF------------------QVDQRSLSPSEKGRNP 221 Query: 332 EKRDRAPNRSVSPRRDDRSPSRSRSRSYSPR 240 ++R+ A S + R + RSPSRS S+SY R Sbjct: 222 KERNHASRGSRTLRANSRSPSRSHSQSYGSR 252 [37][TOP] >UniRef100_C8VUB2 Cell cycle control protein (Cwf22), putative (AFU_orthologue; AFUA_1G03010) n=1 Tax=Aspergillus nidulans FGSC A4 RepID=C8VUB2_EMENI Length = 685 Score = 56.6 bits (135), Expect = 1e-06 Identities = 44/115 (38%), Positives = 51/115 (44%), Gaps = 24/115 (20%) Frame = -3 Query: 515 RVRDDYYSPERSRSYSRSRSPSXGKDYRRSPHPRENGRSP---NDKRDQAPSRSLSPRRD 345 R R S R RSYSRS S S + Y RS + RSP + +R + SRSLS R Sbjct: 485 RSRSRRRSISRGRSYSRSVSGSSRRSYTRSSYTPSRSRSPAPRSRRRSVSYSRSLSRSRS 544 Query: 344 DPPNEKRDRAPNRSVSPRRD---------------------DRSPSRSRSRSYSP 243 P +R R +RS PRR RSPSRS SRS SP Sbjct: 545 SPRRTRRGRTDSRSPPPRRSLSRSVSRSLTPPRRGGRARSYSRSPSRSLSRSVSP 599 [38][TOP] >UniRef100_C0NC04 Pre-mRNA-splicing factor cwc22 n=1 Tax=Ajellomyces capsulatus G186AR RepID=C0NC04_AJECG Length = 932 Score = 56.2 bits (134), Expect = 1e-06 Identities = 44/93 (47%), Positives = 53/93 (56%), Gaps = 7/93 (7%) Frame = -3 Query: 500 YYSPERSRSYSRSRSPSXGK----DYRRSPHPRENGRSPNDKRDQAPSRSLSPRRD-DPP 336 Y RSRSYSRSRSPS G+ + RSP R GRS + R + S S +P R PP Sbjct: 652 YTGSSRSRSYSRSRSPSRGRRRSISFSRSPSSR--GRSLS--RSSSRSYSSTPSRSRTPP 707 Query: 335 NEKRDRAP--NRSVSPRRDDRSPSRSRSRSYSP 243 +RDR P +RS+SP + RSRS SYSP Sbjct: 708 PRRRDRQPPYSRSLSP-----ASHRSRSVSYSP 735 [39][TOP] >UniRef100_Q68FB7 Splicing factor, arginine/serine-rich 7, 35kDa n=1 Tax=Xenopus (Silurana) tropicalis RepID=Q68FB7_XENTR Length = 234 Score = 55.1 bits (131), Expect = 3e-06 Identities = 41/103 (39%), Positives = 50/103 (48%), Gaps = 12/103 (11%) Frame = -3 Query: 515 RVRDDYYSPERSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAP----------SR 366 R R +S R R Y+RSRS S G+ R + R SP R+ P SR Sbjct: 129 RTRSRSHSRSRGRRYTRSRSRSRGRRSRSASPRRSRSASPRRSRNATPRSSRSGSVKRSR 188 Query: 365 SL--SPRRDDPPNEKRDRAPNRSVSPRRDDRSPSRSRSRSYSP 243 SL S R + R R+ +RS SP+R RSPSRS RS SP Sbjct: 189 SLSRSRSRSRSVSRPRSRSKSRSASPKR-SRSPSRSPQRSISP 230 [40][TOP] >UniRef100_B2BXR9 PutRNAbp29 n=1 Tax=Cleome spinosa RepID=B2BXR9_9ROSI Length = 338 Score = 55.1 bits (131), Expect = 3e-06 Identities = 46/97 (47%), Positives = 52/97 (53%), Gaps = 12/97 (12%) Frame = -3 Query: 497 YSPERSRSYS--RSRSPSXGKDYRRSPHPRENGRSPNDKRDQAPSRSLSP-----RRDDP 339 YSP RSRSYS RSRS S YRR+ + SP +RD + SRS SP RR D Sbjct: 167 YSPSRSRSYSSNRSRSRSYSPSYRRT----RSSYSPYYRRDGSYSRSRSPDVCYYRRRDR 222 Query: 338 PNEKRDRAPNRSVSP--RRDDRSPS---RSRSRSYSP 243 R +RS +P RR DRS S R R RSYSP Sbjct: 223 SYSPYYRRRDRSYTPYDRRRDRSYSPYDRQRDRSYSP 259 [41][TOP] >UniRef100_UPI0000E47B28 PREDICTED: hypothetical protein n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E47B28 Length = 272 Score = 54.7 bits (130), Expect = 4e-06 Identities = 37/85 (43%), Positives = 43/85 (50%) Frame = -3 Query: 494 SPERSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAPSRSLSPRRDDPPNEKRDRA 315 S + SRS SRSRSP + RSP R + + SRS SPR R R+ Sbjct: 115 SSKHSRSRSRSRSPRRYRSRSRSPRRRSPVYKRSKSHSRLRSRSKSPRPHSRSRSPRPRS 174 Query: 314 PNRSVSPRRDDRSPSRSRSRSYSPR 240 +RS PR RSP R RSRS SPR Sbjct: 175 RSRSPRPRSRSRSP-RPRSRSRSPR 198 Score = 54.3 bits (129), Expect = 5e-06 Identities = 42/99 (42%), Positives = 46/99 (46%), Gaps = 7/99 (7%) Frame = -3 Query: 515 RVRDDYYSPERSRSYSRSRSPSXGKDYR-RSPHPRENGRSPNDKRDQAPSRSLSPRRDDP 339 R R Y +S S RSRS S R RSP PR RSP + SRS SPR Sbjct: 139 RRRSPVYKRSKSHSRLRSRSKSPRPHSRSRSPRPRSRSRSPRPR-----SRSRSPRPRSR 193 Query: 338 PNEKRDRAPNRSVSPRRDDRSP------SRSRSRSYSPR 240 R R+ +RS PR RSP R RSRS SPR Sbjct: 194 SRSPRPRSRSRSPRPRSRSRSPCSRSRSPRPRSRSRSPR 232 [42][TOP] >UniRef100_UPI000069E9A2 MGC79485 protein. n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069E9A2 Length = 234 Score = 54.7 bits (130), Expect = 4e-06 Identities = 41/103 (39%), Positives = 50/103 (48%), Gaps = 12/103 (11%) Frame = -3 Query: 515 RVRDDYYSPERSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAP----------SR 366 R R +S R R Y+RSRS S G+ R + R SP R+ P SR Sbjct: 129 RTRSRSHSRSRGRRYTRSRSRSRGRRSRSASPRRSRSASPRRSRNATPRSSRSGSVKRSR 188 Query: 365 SL--SPRRDDPPNEKRDRAPNRSVSPRRDDRSPSRSRSRSYSP 243 SL S R + R R+ +RS SP+R RSPSRS RS SP Sbjct: 189 SLSRSRSRSRSVSRPRSRSKSRSASPKR-SRSPSRSPRRSISP 230 [43][TOP] >UniRef100_A4R4V5 Putative uncharacterized protein n=1 Tax=Magnaporthe grisea RepID=A4R4V5_MAGGR Length = 1008 Score = 54.7 bits (130), Expect = 4e-06 Identities = 38/90 (42%), Positives = 45/90 (50%) Frame = -3 Query: 509 RDDYYSPERSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAPSRSLSPRRDDPPNE 330 RDD R R SRSRS S +D R + R +RD++ S SL RRD + Sbjct: 906 RDDRRDDRRERRRSRSRSRSPRRDRERDSY---RDRDRTSRRDRSRSASLMRRRDR--SR 960 Query: 329 KRDRAPNRSVSPRRDDRSPSRSRSRSYSPR 240 +RDRA NR R DR R RSRS S R Sbjct: 961 ERDRARNRDRDRERSDRPSRRDRSRSVSVR 990 [44][TOP] >UniRef100_UPI0001555030 PREDICTED: similar to splicing factor, arginine/serine-rich 7, 35kDa, partial n=1 Tax=Ornithorhynchus anatinus RepID=UPI0001555030 Length = 228 Score = 54.3 bits (129), Expect = 5e-06 Identities = 42/104 (40%), Positives = 50/104 (48%), Gaps = 9/104 (8%) Frame = -3 Query: 515 RVRDDYYSPERSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAPSRSLS---PRRD 345 R R +S R R YSRSRS S G+ R + R SP R +P RS S R Sbjct: 119 RSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSASPRRSRSASPRRSRSGSLKRSR 178 Query: 344 DPPNEKRDRAPNRSVSPRRDDRS------PSRSRSRSYSPR*SA 231 + R R+ +RS+S R RS P RSRS S SPR SA Sbjct: 179 YFESRSRSRSRSRSISRPRSSRSKSRSPTPKRSRSPSGSPRRSA 222 [45][TOP] >UniRef100_UPI0000585452 PREDICTED: similar to ENSANGP00000021579 n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000585452 Length = 311 Score = 54.3 bits (129), Expect = 5e-06 Identities = 42/90 (46%), Positives = 52/90 (57%), Gaps = 6/90 (6%) Frame = -3 Query: 494 SPERSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAPSRSLSPR-RDDPPNEKRDR 318 S RSRS+SRSRS S RRS PR RS + R ++ SRS R R P + R Sbjct: 206 SRRRSRSHSRSRSRSR----RRSRSPRSRSRSHSRSRSRSRSRSRKSRSRSKSPRKSPKR 261 Query: 317 APNRSVSP-RRDDRSPSRSR----SRSYSP 243 + +RS+SP +RD RS SRS+ SRS SP Sbjct: 262 SRSRSLSPMKRDSRSCSRSKSPRNSRSPSP 291 [46][TOP] >UniRef100_A7MB38 SFRS4 protein n=1 Tax=Bos taurus RepID=A7MB38_BOVIN Length = 493 Score = 54.3 bits (129), Expect = 5e-06 Identities = 31/83 (37%), Positives = 44/83 (53%) Frame = -3 Query: 494 SPERSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAPSRSLSPRRDDPPNEKRDRA 315 S RSRS SRSRS S + RS +E RSP+ + ++ SRS RR + ++ Sbjct: 218 SRSRSRSGSRSRSKSRSRSQSRSRSKKEKSRSPSKDKSRSRSRSADKRRSKSKDPAEEKV 277 Query: 314 PNRSVSPRRDDRSPSRSRSRSYS 246 N + + RSPSR +S+S S Sbjct: 278 QNSDRTGKSKSRSPSRHKSKSRS 300 [47][TOP] >UniRef100_C3ZX14 Putative uncharacterized protein (Fragment) n=1 Tax=Branchiostoma floridae RepID=C3ZX14_BRAFL Length = 152 Score = 54.3 bits (129), Expect = 5e-06 Identities = 36/92 (39%), Positives = 50/92 (54%), Gaps = 7/92 (7%) Frame = -3 Query: 494 SPERSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAPSRSLSPRRDDPPNE----- 330 SP R S SR +SP+ G RR P + P+ KR Q+P SP+R P+ Sbjct: 44 SPSRKPSESRGQSPTRGSSPRRGQSPN---KGPSTKRGQSPHSGQSPKRGQSPSNRVPSP 100 Query: 329 KRDRAPNRSVSPRRDDRSPSRSRS--RSYSPR 240 KR+++PNR S R +SP+R +S R +SPR Sbjct: 101 KRNQSPNRGPSLNR-GQSPNRGQSPKRVHSPR 131 [48][TOP] >UniRef100_UPI00005A0294 PREDICTED: similar to Splicing factor, arginine/serine-rich 4 isoform 3 n=1 Tax=Canis lupus familiaris RepID=UPI00005A0294 Length = 377 Score = 53.9 bits (128), Expect = 7e-06 Identities = 42/105 (40%), Positives = 55/105 (52%), Gaps = 8/105 (7%) Frame = -3 Query: 515 RVRDDYYSPERSRSYSRSRSPSXGKDYRRSPHPREN-GRSPNDKRDQAPSRSLSPRRDDP 339 R+ +D R RSYSRSRS S + RS H R++ RS + K + SRS S Sbjct: 48 RLVEDKPGSRRRRSYSRSRSHSRSRS--RSRHSRKSRSRSGSSKSSHSKSRSRSRSGSHS 105 Query: 338 PNEKRDRAPNRSVS-------PRRDDRSPSRSRSRSYSPR*SAIK 225 ++ R R+ +RS S P +DD+S SRSRSRS R S K Sbjct: 106 RSKSRSRSQSRSRSKKEKSRSPSKDDKSRSRSRSRSADKRRSKSK 150 [49][TOP] >UniRef100_UPI0000436D09 serine/arginine repetitive matrix 1 n=1 Tax=Danio rerio RepID=UPI0000436D09 Length = 896 Score = 53.9 bits (128), Expect = 7e-06 Identities = 36/83 (43%), Positives = 42/83 (50%) Frame = -3 Query: 488 ERSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAPSRSLSPRRDDPPNEKRDRAPN 309 +R R SRSRSP R PR RS + +R +P R +SPRR PP + Sbjct: 274 DRPRHRSRSRSP------RSRRRPRSRSRSFSPRRRTSPRRRISPRRRSPPRRQPPSRHR 327 Query: 308 RSVSPRRDDRSPSRSRSRSYSPR 240 RS SP R RS SRS S S S R Sbjct: 328 RSRSPVRRRRSRSRSSSGSSSSR 350 [50][TOP] >UniRef100_UPI0000ECC953 UPI0000ECC953 related cluster n=1 Tax=Gallus gallus RepID=UPI0000ECC953 Length = 235 Score = 53.9 bits (128), Expect = 7e-06 Identities = 40/101 (39%), Positives = 49/101 (48%), Gaps = 6/101 (5%) Frame = -3 Query: 515 RVRDDYYSPERSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAPSRSLSPRRDDPP 336 R R S R R YSRSRS S G+ R + + R SP R +P RS S Sbjct: 129 RSRSRSRSRSRGRRYSRSRSRSRGRRSRSASYRRSRSVSPRRSRSVSPRRSRSGSLKRSR 188 Query: 335 NEKRDRAPNRSVSPRRDDR------SPSRSRSRSYSPR*SA 231 + R R+ +RSV+ R R SP RSRS S SP+ SA Sbjct: 189 SRSRSRSRSRSVTWPRSSRSKSRSPSPKRSRSPSGSPQRSA 229 Score = 53.5 bits (127), Expect = 9e-06 Identities = 42/93 (45%), Positives = 49/93 (52%), Gaps = 7/93 (7%) Frame = -3 Query: 500 YYSPERSRSYSRSRSPSXGKDYRRSPHPRENGR-----SPNDKRDQAP--SRSLSPRRDD 342 Y RSRS SRSRS S G+ Y RS R GR S R +P SRS+SPRR Sbjct: 122 YSRRRRSRSRSRSRSRSRGRRYSRS-RSRSRGRRSRSASYRRSRSVSPRRSRSVSPRRSR 180 Query: 341 PPNEKRDRAPNRSVSPRRDDRSPSRSRSRSYSP 243 + KR R+ +RS S R P SRS+S SP Sbjct: 181 SGSLKRSRSRSRSRSRSRSVTWPRSSRSKSRSP 213 [51][TOP] >UniRef100_Q6AZV4 MGC78845 protein n=1 Tax=Xenopus laevis RepID=Q6AZV4_XENLA Length = 224 Score = 53.9 bits (128), Expect = 7e-06 Identities = 40/101 (39%), Positives = 47/101 (46%), Gaps = 10/101 (9%) Frame = -3 Query: 515 RVRDDYYSPERSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAP----------SR 366 R R +S R R Y+RSRS S G R + R SP R P SR Sbjct: 121 RSRSRSHSRSRGRRYTRSRSRSRGVRSRSASPRRSRSVSPRRSRSATPRRSRSGSVKRSR 180 Query: 365 SLSPRRDDPPNEKRDRAPNRSVSPRRDDRSPSRSRSRSYSP 243 S S R + R R+ +RS SP+R RSPSRS RS SP Sbjct: 181 SRSRSRSRSRSHPRSRSKSRSASPKR-SRSPSRSPRRSISP 220 [52][TOP] >UniRef100_Q06VE0 Putative uncharacterized protein n=1 Tax=Trichoplusia ni ascovirus 2c RepID=Q06VE0_TNAVC Length = 648 Score = 53.9 bits (128), Expect = 7e-06 Identities = 41/88 (46%), Positives = 47/88 (53%), Gaps = 3/88 (3%) Frame = -3 Query: 494 SPERSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAPSRSLSPRRDDPPNEKRDRA 315 S RSRS SR RSPS + RS R RSP+ R + SRS S RR P R R+ Sbjct: 262 SRSRSRSASRRRSPSPARSRSRSASRR---RSPSPARSR--SRSASRRRSPSPARSRSRS 316 Query: 314 PNRSVSP---RRDDRSPSRSRSRSYSPR 240 +R SP R RS +RSRSRS S R Sbjct: 317 ASRRRSPSPARSKSRSQTRSRSRSTSRR 344 [53][TOP] >UniRef100_B4NKX2 GK13280 n=1 Tax=Drosophila willistoni RepID=B4NKX2_DROWI Length = 958 Score = 53.9 bits (128), Expect = 7e-06 Identities = 38/88 (43%), Positives = 47/88 (53%), Gaps = 3/88 (3%) Frame = -3 Query: 494 SPERSRSYSRSRSPSXGK--DYRRSPHPRENGRSPNDKRDQAPSRSLSPRRDDPPNEKRD 321 S R RS+ RSPS + S H R RS +R + PS + PRR P+E+ Sbjct: 758 SSSRPRSHRSRRSPSRSRYGHSSYSQHRRSKSRSLEQRRRRTPSPFV-PRRTPSPSERYR 816 Query: 320 RAPNRSVSPR-RDDRSPSRSRSRSYSPR 240 R P+RS R R +S S SRSRSYSPR Sbjct: 817 RTPSRSRYRRSRSPQSRSHSRSRSYSPR 844 [54][TOP] >UniRef100_UPI0000E48B78 PREDICTED: hypothetical protein n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E48B78 Length = 1030 Score = 53.5 bits (127), Expect = 9e-06 Identities = 35/81 (43%), Positives = 41/81 (50%), Gaps = 2/81 (2%) Frame = -3 Query: 494 SPER--SRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAPSRSLSPRRDDPPNEKRD 321 SP R RS +RSRS +D+RR R RSP +R +P R P R P D Sbjct: 337 SPRRRDKRSRTRSRSRDRRRDFRRRSGSRTRHRSPR-RRSPSPRRRTPPPRRRSPRRSPD 395 Query: 320 RAPNRSVSPRRDDRSPSRSRS 258 R +R PRR RSP RSRS Sbjct: 396 RRRSRPSPPRRPRRSPIRSRS 416 [55][TOP] >UniRef100_UPI000069E9A3 MGC79485 protein. n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069E9A3 Length = 226 Score = 53.5 bits (127), Expect = 9e-06 Identities = 40/103 (38%), Positives = 50/103 (48%), Gaps = 12/103 (11%) Frame = -3 Query: 515 RVRDDYYSPERSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAP----------SR 366 + R +S R R Y+RSRS S G+ R + R SP R+ P SR Sbjct: 121 KTRSRSHSRSRGRRYTRSRSRSRGRRSRSASPRRSRSASPRRSRNATPRSSRSGSVKRSR 180 Query: 365 SL--SPRRDDPPNEKRDRAPNRSVSPRRDDRSPSRSRSRSYSP 243 SL S R + R R+ +RS SP+R RSPSRS RS SP Sbjct: 181 SLSRSRSRSRSVSRPRSRSKSRSASPKR-SRSPSRSPRRSISP 222 [56][TOP] >UniRef100_UPI0000ECC954 UPI0000ECC954 related cluster n=1 Tax=Gallus gallus RepID=UPI0000ECC954 Length = 226 Score = 53.5 bits (127), Expect = 9e-06 Identities = 42/93 (45%), Positives = 49/93 (52%), Gaps = 7/93 (7%) Frame = -3 Query: 500 YYSPERSRSYSRSRSPSXGKDYRRSPHPRENGR-----SPNDKRDQAP--SRSLSPRRDD 342 Y RSRS SRSRS S G+ Y RS R GR S R +P SRS+SPRR Sbjct: 123 YSRRRRSRSRSRSRSRSRGRRYSRS-RSRSRGRRSRSASYRRSRSVSPRRSRSVSPRRSR 181 Query: 341 PPNEKRDRAPNRSVSPRRDDRSPSRSRSRSYSP 243 + KR R+ +RS S R P SRS+S SP Sbjct: 182 SGSLKRSRSRSRSRSRSRSVTWPRSSRSKSRSP 214 [57][TOP] >UniRef100_B9I218 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9I218_POPTR Length = 280 Score = 53.5 bits (127), Expect = 9e-06 Identities = 40/99 (40%), Positives = 49/99 (49%) Frame = -3 Query: 515 RVRDDYYSPERSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAPSRSLSPRRDDPP 336 RV+ SP RSRS RSRS S R RSP R ++ RS+S R Sbjct: 196 RVKQYEGSPSRSRSRGRSRSRS-----------RSRSRSPRRNRSKSLERSVSRSR---- 240 Query: 335 NEKRDRAPNRSVSPRRDDRSPSRSRSRSYSPR*SAIKLV 219 + R R+ RS SP + R SRSRSRS SP ++ LV Sbjct: 241 SRSRSRSKTRSASPLKSSRPKSRSRSRSESPTKASPPLV 279 [58][TOP] >UniRef100_C0S8F4 Putative uncharacterized protein n=1 Tax=Paracoccidioides brasiliensis Pb03 RepID=C0S8F4_PARBP Length = 675 Score = 53.5 bits (127), Expect = 9e-06 Identities = 33/83 (39%), Positives = 48/83 (57%), Gaps = 1/83 (1%) Frame = -3 Query: 485 RSRSYSRSRSPSXGKDYRRSPHPRENGRSPNDKRDQAPSRSLSPRRDDPPNEKRDRAPNR 306 R+RS SRSRS S D R+ ++ S + +R ++P S+SPRR + R + +R Sbjct: 401 RNRSRSRSRSRSRSYDTRKRRRYSDSISSDDRERSKSPGSSISPRRSRSRSHSRSISRSR 460 Query: 305 S-VSPRRDDRSPSRSRSRSYSPR 240 S +PRR S +RS+SYSPR Sbjct: 461 SRTAPRRAGHRRSGTRSKSYSPR 483