[UP]
[1][TOP] >UniRef100_B9RRM3 Exocyst componenet sec8, putative n=1 Tax=Ricinus communis RepID=B9RRM3_RICCO Length = 379 Score = 60.5 bits (145), Expect = 7e-08 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -2 Query: 511 HVHLFTAIEYANLLNVQVXGREIPPDGQDRVSEILSL 401 H H+FTA EYANLL VQV GREIPPD Q+RVSEIL L Sbjct: 343 HDHVFTAAEYANLLKVQVPGREIPPDAQERVSEILFL 379 [2][TOP] >UniRef100_B9HUJ3 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HUJ3_POPTR Length = 1084 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = -2 Query: 511 HVHLFTAIEYANLLNVQVXGREIPPDGQDRVSEILS 404 H +LFT EYANLL V V GREIPPD QDRVS ILS Sbjct: 1048 HENLFTPAEYANLLKVNVLGREIPPDAQDRVSYILS 1083 [3][TOP] >UniRef100_UPI000198485F PREDICTED: similar to SEC8 (secretion 8) isoform 2 n=1 Tax=Vitis vinifera RepID=UPI000198485F Length = 892 Score = 53.9 bits (128), Expect = 6e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -2 Query: 511 HVHLFTAIEYANLLNVQVXGREIPPDGQDRVSEILS 404 H +LFTA EY NLL VQV GREIP D ++RVSEILS Sbjct: 856 HENLFTATEYTNLLKVQVPGREIPADARERVSEILS 891 [4][TOP] >UniRef100_UPI000198485E PREDICTED: similar to SEC8 (secretion 8) isoform 1 n=1 Tax=Vitis vinifera RepID=UPI000198485E Length = 1076 Score = 53.9 bits (128), Expect = 6e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -2 Query: 511 HVHLFTAIEYANLLNVQVXGREIPPDGQDRVSEILS 404 H +LFTA EY NLL VQV GREIP D ++RVSEILS Sbjct: 1040 HENLFTATEYTNLLKVQVPGREIPADARERVSEILS 1075