[UP]
[1][TOP]
>UniRef100_C6TML7 Putative uncharacterized protein n=1 Tax=Glycine max
RepID=C6TML7_SOYBN
Length = 377
Score = 83.2 bits (204), Expect = 8e-15
Identities = 40/40 (100%), Positives = 40/40 (100%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct: 338 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 377
[2][TOP]
>UniRef100_C3W4Q2 Chlorophyll synthase n=1 Tax=Nicotiana tabacum RepID=C3W4Q2_TOBAC
Length = 373
Score = 82.8 bits (203), Expect = 1e-14
Identities = 39/40 (97%), Positives = 40/40 (100%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
VFFQFKYFLKDPVKYDVKYQASAQPFL+LGLLVTALATSH
Sbjct: 334 VFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 373
[3][TOP]
>UniRef100_C3W4Q1 Chlorophyll synthase n=1 Tax=Nicotiana tabacum RepID=C3W4Q1_TOBAC
Length = 373
Score = 82.8 bits (203), Expect = 1e-14
Identities = 39/40 (97%), Positives = 40/40 (100%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
VFFQFKYFLKDPVKYDVKYQASAQPFL+LGLLVTALATSH
Sbjct: 334 VFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 373
[4][TOP]
>UniRef100_B4G0I5 Putative uncharacterized protein n=1 Tax=Zea mays
RepID=B4G0I5_MAIZE
Length = 378
Score = 80.1 bits (196), Expect = 7e-14
Identities = 38/40 (95%), Positives = 39/40 (97%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
VFFQF+YFLKDPVKYDVKYQASAQPF VLGLLVTALATSH
Sbjct: 339 VFFQFQYFLKDPVKYDVKYQASAQPFFVLGLLVTALATSH 378
[5][TOP]
>UniRef100_B9IGC2 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IGC2_POPTR
Length = 329
Score = 79.3 bits (194), Expect = 1e-13
Identities = 37/40 (92%), Positives = 40/40 (100%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
VFFQF+YFLKDPVKYDV+YQASAQPFLVLGLLVTALAT+H
Sbjct: 290 VFFQFQYFLKDPVKYDVRYQASAQPFLVLGLLVTALATNH 329
[6][TOP]
>UniRef100_A7QHN8 Chromosome chr8 scaffold_99, whole genome shotgun sequence n=1
Tax=Vitis vinifera RepID=A7QHN8_VITVI
Length = 370
Score = 79.3 bits (194), Expect = 1e-13
Identities = 38/40 (95%), Positives = 39/40 (97%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
V FQF+YFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct: 331 VIFQFQYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 370
[7][TOP]
>UniRef100_B9SWY8 Bacteriochlorophyll synthase, putative n=1 Tax=Ricinus communis
RepID=B9SWY8_RICCO
Length = 344
Score = 79.0 bits (193), Expect = 2e-13
Identities = 38/40 (95%), Positives = 39/40 (97%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
V FQF+YFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct: 305 VVFQFQYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 344
[8][TOP]
>UniRef100_C5YWC9 Putative uncharacterized protein Sb09g016840 n=1 Tax=Sorghum
bicolor RepID=C5YWC9_SORBI
Length = 382
Score = 78.6 bits (192), Expect = 2e-13
Identities = 37/40 (92%), Positives = 38/40 (95%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
VFFQF+YFLKDPVKYDVKYQASAQPF V GLLVTALATSH
Sbjct: 343 VFFQFQYFLKDPVKYDVKYQASAQPFFVFGLLVTALATSH 382
[9][TOP]
>UniRef100_A9PF76 Predicted protein n=1 Tax=Populus trichocarpa RepID=A9PF76_POPTR
Length = 372
Score = 78.6 bits (192), Expect = 2e-13
Identities = 37/40 (92%), Positives = 39/40 (97%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQF+YFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct: 333 IVFQFQYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 372
[10][TOP]
>UniRef100_B8AX06 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
RepID=B8AX06_ORYSI
Length = 359
Score = 77.4 bits (189), Expect = 5e-13
Identities = 37/40 (92%), Positives = 38/40 (95%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
V FQF+YFLKDPVKYDVKYQASAQPF VLGLLVTALATSH
Sbjct: 320 VVFQFQYFLKDPVKYDVKYQASAQPFFVLGLLVTALATSH 359
[11][TOP]
>UniRef100_Q5W6H5 Chlorophyll synthase, chloroplastic n=3 Tax=Oryza sativa
RepID=CHLG_ORYSJ
Length = 376
Score = 77.4 bits (189), Expect = 5e-13
Identities = 37/40 (92%), Positives = 38/40 (95%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
V FQF+YFLKDPVKYDVKYQASAQPF VLGLLVTALATSH
Sbjct: 337 VVFQFQYFLKDPVKYDVKYQASAQPFFVLGLLVTALATSH 376
[12][TOP]
>UniRef100_Q38833 Chlorophyll synthase, chloroplastic n=1 Tax=Arabidopsis thaliana
RepID=CHLG_ARATH
Length = 387
Score = 74.7 bits (182), Expect = 3e-12
Identities = 34/40 (85%), Positives = 37/40 (92%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQFKYFLKDPVKYDVKYQASAQPFLVLG+ VTALA+ H
Sbjct: 348 IVFQFKYFLKDPVKYDVKYQASAQPFLVLGIFVTALASQH 387
[13][TOP]
>UniRef100_C0PT82 Putative uncharacterized protein n=1 Tax=Picea sitchensis
RepID=C0PT82_PICSI
Length = 388
Score = 74.3 bits (181), Expect = 4e-12
Identities = 34/40 (85%), Positives = 37/40 (92%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ QF+YFLKDP+KYDVKYQASAQPFLVLGLL TALATSH
Sbjct: 349 IILQFQYFLKDPIKYDVKYQASAQPFLVLGLLCTALATSH 388
[14][TOP]
>UniRef100_B8LRB3 Putative uncharacterized protein n=1 Tax=Picea sitchensis
RepID=B8LRB3_PICSI
Length = 388
Score = 74.3 bits (181), Expect = 4e-12
Identities = 34/40 (85%), Positives = 37/40 (92%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ QF+YFLKDP+KYDVKYQASAQPFLVLGLL TALATSH
Sbjct: 349 IILQFQYFLKDPIKYDVKYQASAQPFLVLGLLCTALATSH 388
[15][TOP]
>UniRef100_Q9M3W5 Chlorophyll synthase, chloroplastic n=1 Tax=Avena sativa
RepID=CHLG_AVESA
Length = 378
Score = 73.9 bits (180), Expect = 5e-12
Identities = 35/40 (87%), Positives = 36/40 (90%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
V QF+YFLKDPVKYDVKYQASAQPF V GLLVTALATSH
Sbjct: 339 VILQFQYFLKDPVKYDVKYQASAQPFFVFGLLVTALATSH 378
[16][TOP]
>UniRef100_A9REQ5 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens
RepID=A9REQ5_PHYPA
Length = 342
Score = 68.9 bits (167), Expect = 2e-10
Identities = 32/40 (80%), Positives = 34/40 (85%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ QFKY L DPVKYDVKYQASAQPF V GLL+TALATSH
Sbjct: 303 IILQFKYLLVDPVKYDVKYQASAQPFFVFGLLLTALATSH 342
[17][TOP]
>UniRef100_C1MSS6 Chlorophyll synthetase n=1 Tax=Micromonas pusilla CCMP1545
RepID=C1MSS6_9CHLO
Length = 361
Score = 67.0 bits (162), Expect = 6e-10
Identities = 33/46 (71%), Positives = 36/46 (78%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH*SQHMN 266
+FFQFK+FL DPVK DVKYQASAQPFLV GLL T LA H H+N
Sbjct: 315 IFFQFKFFLPDPVKNDVKYQASAQPFLVFGLLTTGLAWGH---HIN 357
[18][TOP]
>UniRef100_C1E960 Chlorophyll synthetase n=1 Tax=Micromonas sp. RCC299
RepID=C1E960_9CHLO
Length = 395
Score = 66.6 bits (161), Expect = 8e-10
Identities = 32/46 (69%), Positives = 36/46 (78%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH*SQHMN 266
+FFQFK+FL DP+K DVKYQASAQPFLV GLL T LA H H+N
Sbjct: 349 IFFQFKFFLPDPIKNDVKYQASAQPFLVFGLLTTGLAWGH---HIN 391
[19][TOP]
>UniRef100_A4S148 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901
RepID=A4S148_OSTLU
Length = 317
Score = 66.6 bits (161), Expect = 8e-10
Identities = 32/46 (69%), Positives = 36/46 (78%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH*SQHMN 266
+FFQFK+FL DP+K DVKYQASAQPFLV GLL T LA H H+N
Sbjct: 271 IFFQFKFFLPDPIKNDVKYQASAQPFLVFGLLTTGLAWGH---HIN 313
[20][TOP]
>UniRef100_Q7XYK8 Chlorophyll synthetase n=1 Tax=Bigelowiella natans
RepID=Q7XYK8_BIGNA
Length = 498
Score = 62.8 bits (151), Expect = 1e-08
Identities = 28/40 (70%), Positives = 33/40 (82%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+FFQ KY LKDP+KYDV YQA++QPFLV G+L TALA H
Sbjct: 456 MFFQNKYLLKDPIKYDVNYQAASQPFLVFGILDTALAMGH 495
[21][TOP]
>UniRef100_A8JFJ1 Chlorophyll synthetase n=1 Tax=Chlamydomonas reinhardtii
RepID=A8JFJ1_CHLRE
Length = 383
Score = 62.0 bits (149), Expect = 2e-08
Identities = 29/46 (63%), Positives = 34/46 (73%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH*SQHMN 266
++FQ+KYFL DP+ DVKYQASAQPFLV GLL LA H H+N
Sbjct: 329 IYFQYKYFLPDPIANDVKYQASAQPFLVFGLLTAGLACGH---HVN 371
[22][TOP]
>UniRef100_Q31LF5 Chlorophyll synthase n=2 Tax=Synechococcus elongatus
RepID=Q31LF5_SYNE7
Length = 339
Score = 60.8 bits (146), Expect = 4e-08
Identities = 29/40 (72%), Positives = 33/40 (82%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ YFL+DP+ DVKYQASAQPFLVLG+LVTALA H
Sbjct: 293 ITFQDMYFLRDPLGNDVKYQASAQPFLVLGMLVTALAIGH 332
[23][TOP]
>UniRef100_B2IVS8 Chlorophyll synthase, ChlG n=1 Tax=Nostoc punctiforme PCC 73102
RepID=B2IVS8_NOSP7
Length = 348
Score = 60.8 bits (146), Expect = 4e-08
Identities = 29/40 (72%), Positives = 32/40 (80%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ Q YFL+DPVK DVKYQASAQPFLVLG+LVT LA H
Sbjct: 306 ITLQDMYFLRDPVKNDVKYQASAQPFLVLGMLVTGLALGH 345
[24][TOP]
>UniRef100_A9BE45 Chlorophyll synthase 33 kD subunit n=1 Tax=Prochlorococcus marinus
str. MIT 9211 RepID=A9BE45_PROM4
Length = 316
Score = 60.8 bits (146), Expect = 4e-08
Identities = 28/40 (70%), Positives = 33/40 (82%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ + L DP+KYDVKYQASAQPFL+LG+LVTALA H
Sbjct: 271 ITFQDIWLLNDPLKYDVKYQASAQPFLILGMLVTALAIGH 310
[25][TOP]
>UniRef100_A5GMN7 Chlorophyll synthase 33 kD subunit n=1 Tax=Synechococcus sp. WH
7803 RepID=A5GMN7_SYNPW
Length = 317
Score = 60.8 bits (146), Expect = 4e-08
Identities = 29/40 (72%), Positives = 33/40 (82%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ + L+DPV YDVKYQASAQPFLVLG+LVTALA H
Sbjct: 271 ITFQDIWLLRDPVAYDVKYQASAQPFLVLGMLVTALAIGH 310
[26][TOP]
>UniRef100_A4CWD5 Bacteriochlorophyll a synthase n=1 Tax=Synechococcus sp. WH 7805
RepID=A4CWD5_SYNPV
Length = 317
Score = 60.8 bits (146), Expect = 4e-08
Identities = 29/40 (72%), Positives = 33/40 (82%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ + L+DPV YDVKYQASAQPFLVLG+LVTALA H
Sbjct: 271 ITFQDIWLLRDPVAYDVKYQASAQPFLVLGMLVTALAIGH 310
[27][TOP]
>UniRef100_Q8DIP2 Chlorophyll a synthase n=1 Tax=Thermosynechococcus elongatus BP-1
RepID=Q8DIP2_THEEB
Length = 350
Score = 60.5 bits (145), Expect = 6e-08
Identities = 28/40 (70%), Positives = 32/40 (80%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ YFL+DP+K DVKYQASAQPFLVLG+LV LA H
Sbjct: 308 IVFQDMYFLRDPLKNDVKYQASAQPFLVLGMLVVGLALGH 347
[28][TOP]
>UniRef100_Q7U5M6 Chlorophyll synthase 33 kD subunit n=1 Tax=Synechococcus sp. WH
8102 RepID=Q7U5M6_SYNPX
Length = 336
Score = 60.5 bits (145), Expect = 6e-08
Identities = 28/40 (70%), Positives = 34/40 (85%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ + L+DPV++DVKYQASAQPFLVLG+LVTALA H
Sbjct: 290 ITFQDIWLLRDPVEFDVKYQASAQPFLVLGMLVTALAVGH 329
[29][TOP]
>UniRef100_B1WRM9 Chlorophyll a synthase n=1 Tax=Cyanothece sp. ATCC 51142
RepID=B1WRM9_CYAA5
Length = 326
Score = 60.5 bits (145), Expect = 6e-08
Identities = 28/40 (70%), Positives = 33/40 (82%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ YFL+DP++ DVKYQASAQPFLVLG+LVT LA H
Sbjct: 284 ITFQDMYFLRDPLENDVKYQASAQPFLVLGMLVTGLALGH 323
[30][TOP]
>UniRef100_Q05X46 Bacteriochlorophyll a synthase n=1 Tax=Synechococcus sp. RS9916
RepID=Q05X46_9SYNE
Length = 317
Score = 60.5 bits (145), Expect = 6e-08
Identities = 28/40 (70%), Positives = 34/40 (85%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ + L+DPV++DVKYQASAQPFLVLG+LVTALA H
Sbjct: 271 ITFQDIWLLRDPVEFDVKYQASAQPFLVLGMLVTALAVGH 310
[31][TOP]
>UniRef100_Q8YNT1 Chlorophyll synthase 33 kD subunit n=1 Tax=Nostoc sp. PCC 7120
RepID=Q8YNT1_ANASP
Length = 344
Score = 60.1 bits (144), Expect = 8e-08
Identities = 28/40 (70%), Positives = 32/40 (80%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ YFL+DP+K DVKYQASAQPFLVLG+LV LA H
Sbjct: 302 ITFQDMYFLRDPLKNDVKYQASAQPFLVLGMLVAGLALGH 341
[32][TOP]
>UniRef100_Q3M7T8 Chlorophyll synthase n=1 Tax=Anabaena variabilis ATCC 29413
RepID=Q3M7T8_ANAVT
Length = 337
Score = 60.1 bits (144), Expect = 8e-08
Identities = 28/40 (70%), Positives = 32/40 (80%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ YFL+DP+K DVKYQASAQPFLVLG+LV LA H
Sbjct: 295 ITFQDMYFLRDPLKNDVKYQASAQPFLVLGMLVAGLALGH 334
[33][TOP]
>UniRef100_Q0ICA8 Chlorophyll synthase, ChlG n=1 Tax=Synechococcus sp. CC9311
RepID=Q0ICA8_SYNS3
Length = 308
Score = 60.1 bits (144), Expect = 8e-08
Identities = 28/40 (70%), Positives = 34/40 (85%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ + L+DPV++DVKYQASAQPFLVLG+LVTALA H
Sbjct: 262 ITFQDIWLLRDPVEFDVKYQASAQPFLVLGMLVTALAIGH 301
[34][TOP]
>UniRef100_B8HUG0 Chlorophyll synthase, ChlG n=1 Tax=Cyanothece sp. PCC 7425
RepID=B8HUG0_CYAP4
Length = 340
Score = 60.1 bits (144), Expect = 8e-08
Identities = 28/40 (70%), Positives = 32/40 (80%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ YFL+DP+K DVKYQASAQPFLVLG+LV LA H
Sbjct: 298 ITFQDMYFLRDPLKNDVKYQASAQPFLVLGMLVVGLALGH 337
[35][TOP]
>UniRef100_B1XPS7 Chlorophyll synthase, ChlG n=1 Tax=Synechococcus sp. PCC 7002
RepID=B1XPS7_SYNP2
Length = 355
Score = 60.1 bits (144), Expect = 8e-08
Identities = 28/40 (70%), Positives = 32/40 (80%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ YFL+DP+K DVKYQASAQPFLVLG+LV LA H
Sbjct: 312 ITFQDMYFLRDPLKNDVKYQASAQPFLVLGMLVAGLAMGH 351
[36][TOP]
>UniRef100_B0C0T5 Chlorophyll synthase, ChlG n=1 Tax=Acaryochloris marina MBIC11017
RepID=B0C0T5_ACAM1
Length = 350
Score = 60.1 bits (144), Expect = 8e-08
Identities = 29/40 (72%), Positives = 31/40 (77%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ YFL+DPVK DVKYQASAQPFLVLG LV LA H
Sbjct: 308 ITFQDMYFLRDPVKNDVKYQASAQPFLVLGTLVAGLAIGH 347
[37][TOP]
>UniRef100_Q3ALF8 Chlorophyll synthase, ChlG n=1 Tax=Synechococcus sp. CC9605
RepID=Q3ALF8_SYNSC
Length = 317
Score = 59.7 bits (143), Expect = 1e-07
Identities = 28/40 (70%), Positives = 33/40 (82%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ + L+DPV +DVKYQASAQPFLVLG+LVTALA H
Sbjct: 271 ITFQDIWLLRDPVAFDVKYQASAQPFLVLGMLVTALAVGH 310
[38][TOP]
>UniRef100_D0CHI8 Chlorophyll synthase, ChlG n=1 Tax=Synechococcus sp. WH 8109
RepID=D0CHI8_9SYNE
Length = 317
Score = 59.7 bits (143), Expect = 1e-07
Identities = 28/40 (70%), Positives = 33/40 (82%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ + L+DPV +DVKYQASAQPFLVLG+LVTALA H
Sbjct: 271 ITFQDIWLLRDPVAFDVKYQASAQPFLVLGMLVTALAVGH 310
[39][TOP]
>UniRef100_B9YTM1 Chlorophyll synthase, ChlG n=1 Tax='Nostoc azollae' 0708
RepID=B9YTM1_ANAAZ
Length = 343
Score = 59.7 bits (143), Expect = 1e-07
Identities = 27/40 (67%), Positives = 32/40 (80%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ YFL+DP+ DVKYQASAQPFLVLG+LVT +A H
Sbjct: 301 ITFQDMYFLRDPIANDVKYQASAQPFLVLGMLVTGIALGH 340
[40][TOP]
>UniRef100_A3ZA52 Chlorophyll synthase, ChlG n=1 Tax=Synechococcus sp. RS9917
RepID=A3ZA52_9SYNE
Length = 317
Score = 59.7 bits (143), Expect = 1e-07
Identities = 28/40 (70%), Positives = 33/40 (82%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ + L+DPV +DVKYQASAQPFLVLG+LVTALA H
Sbjct: 271 ITFQDIWLLRDPVAFDVKYQASAQPFLVLGMLVTALAVGH 310
[41][TOP]
>UniRef100_Q3AWY2 Chlorophyll synthase n=1 Tax=Synechococcus sp. CC9902
RepID=Q3AWY2_SYNS9
Length = 317
Score = 59.3 bits (142), Expect = 1e-07
Identities = 28/40 (70%), Positives = 33/40 (82%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ + L DPV++DVKYQASAQPFLVLG+LVTALA H
Sbjct: 271 ITFQDIWLLTDPVEFDVKYQASAQPFLVLGMLVTALAVGH 310
[42][TOP]
>UniRef100_B0JG19 Chlorophyll a synthase n=1 Tax=Microcystis aeruginosa NIES-843
RepID=B0JG19_MICAN
Length = 326
Score = 59.3 bits (142), Expect = 1e-07
Identities = 28/37 (75%), Positives = 32/37 (86%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALA 293
+ FQ YFL+DP+K DVKYQASAQPFLVLG+LVT LA
Sbjct: 284 ITFQDMYFLRDPLKNDVKYQASAQPFLVLGMLVTGLA 320
[43][TOP]
>UniRef100_A2C0N5 Chlorophyll synthase 33 kD subunit n=2 Tax=Prochlorococcus marinus
RepID=A2C0N5_PROM1
Length = 316
Score = 59.3 bits (142), Expect = 1e-07
Identities = 26/40 (65%), Positives = 34/40 (85%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ + L+DP+K+DVKYQASAQPFL+LG+LVTA+A H
Sbjct: 271 ITFQDIWLLRDPLKFDVKYQASAQPFLILGMLVTAIAIGH 310
[44][TOP]
>UniRef100_Q060J0 Bacteriochlorophyll a synthase n=1 Tax=Synechococcus sp. BL107
RepID=Q060J0_9SYNE
Length = 317
Score = 59.3 bits (142), Expect = 1e-07
Identities = 28/40 (70%), Positives = 33/40 (82%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ + L DPV++DVKYQASAQPFLVLG+LVTALA H
Sbjct: 271 ITFQDIWLLTDPVEFDVKYQASAQPFLVLGMLVTALAVGH 310
[45][TOP]
>UniRef100_B5INZ8 Chlorophyll synthase, ChlG n=1 Tax=Cyanobium sp. PCC 7001
RepID=B5INZ8_9CHRO
Length = 326
Score = 59.3 bits (142), Expect = 1e-07
Identities = 28/40 (70%), Positives = 33/40 (82%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ + L+DPV +DVKYQASAQPFLVLG+LVTALA H
Sbjct: 282 ITFQDIWLLRDPVAFDVKYQASAQPFLVLGMLVTALAIGH 321
[46][TOP]
>UniRef100_A3Z0Y6 Bacteriochlorophyll a synthase n=1 Tax=Synechococcus sp. WH 5701
RepID=A3Z0Y6_9SYNE
Length = 327
Score = 59.3 bits (142), Expect = 1e-07
Identities = 28/40 (70%), Positives = 33/40 (82%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ + L+DPV +DVKYQASAQPFLVLG+LVTALA H
Sbjct: 281 ITFQDIWLLRDPVAFDVKYQASAQPFLVLGMLVTALAIGH 320
[47][TOP]
>UniRef100_A0ZD76 Bacteriochlorophyll a synthase n=1 Tax=Nodularia spumigena CCY9414
RepID=A0ZD76_NODSP
Length = 346
Score = 59.3 bits (142), Expect = 1e-07
Identities = 27/40 (67%), Positives = 32/40 (80%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ YFL+DP+K DVKYQASAQPFLVLG+LV +A H
Sbjct: 304 ITFQDMYFLRDPLKNDVKYQASAQPFLVLGMLVAGIALGH 343
[48][TOP]
>UniRef100_Q7V2P4 Chlorophyll synthase 33 kD subunit n=1 Tax=Prochlorococcus marinus
subsp. pastoris str. CCMP1986 RepID=Q7V2P4_PROMP
Length = 315
Score = 58.9 bits (141), Expect = 2e-07
Identities = 26/40 (65%), Positives = 33/40 (82%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ + L+DP+K+DVKYQASAQPFL+ G+LVTALA H
Sbjct: 271 ITFQDMWLLRDPLKFDVKYQASAQPFLITGMLVTALAIGH 310
[49][TOP]
>UniRef100_Q31CA7 Chlorophyll synthase n=1 Tax=Prochlorococcus marinus str. MIT 9312
RepID=Q31CA7_PROM9
Length = 315
Score = 58.9 bits (141), Expect = 2e-07
Identities = 26/40 (65%), Positives = 33/40 (82%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ + L+DP+K+DVKYQASAQPFL+ G+LVTALA H
Sbjct: 271 ITFQDMWLLRDPLKFDVKYQASAQPFLITGMLVTALAIGH 310
[50][TOP]
>UniRef100_A8G3E2 Chlorophyll synthase 33 kD subunit n=1 Tax=Prochlorococcus marinus
str. MIT 9215 RepID=A8G3E2_PROM2
Length = 315
Score = 58.9 bits (141), Expect = 2e-07
Identities = 26/40 (65%), Positives = 33/40 (82%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ + L+DP+K+DVKYQASAQPFL+ G+LVTALA H
Sbjct: 271 ITFQDMWLLRDPLKFDVKYQASAQPFLITGMLVTALAIGH 310
[51][TOP]
>UniRef100_A2BV88 ChlG n=1 Tax=Prochlorococcus marinus str. MIT 9515
RepID=A2BV88_PROM5
Length = 315
Score = 58.9 bits (141), Expect = 2e-07
Identities = 26/40 (65%), Positives = 33/40 (82%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ + L+DP+K+DVKYQASAQPFL+ G+LVTALA H
Sbjct: 271 ITFQDMWLLRDPLKFDVKYQASAQPFLITGMLVTALAIGH 310
[52][TOP]
>UniRef100_A2BPR0 Chlorophyll synthase 33 kD subunit n=2 Tax=Prochlorococcus marinus
RepID=A2BPR0_PROMS
Length = 315
Score = 58.9 bits (141), Expect = 2e-07
Identities = 26/40 (65%), Positives = 33/40 (82%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ + L+DP+K+DVKYQASAQPFL+ G+LVTALA H
Sbjct: 271 ITFQDMWLLRDPLKFDVKYQASAQPFLITGMLVTALAIGH 310
[53][TOP]
>UniRef100_B9P0H8 Chlorophyll synthase, ChlG n=1 Tax=Prochlorococcus marinus str. MIT
9202 RepID=B9P0H8_PROMA
Length = 315
Score = 58.9 bits (141), Expect = 2e-07
Identities = 26/40 (65%), Positives = 33/40 (82%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ + L+DP+K+DVKYQASAQPFL+ G+LVTALA H
Sbjct: 271 ITFQDMWLLRDPLKFDVKYQASAQPFLITGMLVTALAIGH 310
[54][TOP]
>UniRef100_B4WSL3 Chlorophyll synthase, ChlG n=1 Tax=Synechococcus sp. PCC 7335
RepID=B4WSL3_9SYNE
Length = 344
Score = 58.9 bits (141), Expect = 2e-07
Identities = 27/40 (67%), Positives = 33/40 (82%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ YFL+DP++ DVKYQASAQPFLVLG+LV A+A H
Sbjct: 300 ITFQDMYFLRDPLENDVKYQASAQPFLVLGMLVMAIALGH 339
[55][TOP]
>UniRef100_A8YGY5 Genome sequencing data, contig C311 n=1 Tax=Microcystis aeruginosa
PCC 7806 RepID=A8YGY5_MICAE
Length = 326
Score = 58.9 bits (141), Expect = 2e-07
Identities = 28/35 (80%), Positives = 31/35 (88%)
Frame = -2
Query: 397 FQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALA 293
FQ YFL+DP+K DVKYQASAQPFLVLG+LVT LA
Sbjct: 286 FQDMYFLRDPLKNDVKYQASAQPFLVLGMLVTGLA 320
[56][TOP]
>UniRef100_Q7VDF3 Chlorophyll synthase 33 kD subunit n=1 Tax=Prochlorococcus marinus
RepID=Q7VDF3_PROMA
Length = 316
Score = 58.5 bits (140), Expect = 2e-07
Identities = 26/40 (65%), Positives = 34/40 (85%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ + L+DP+++DVKYQASAQPFL+LG+LVTALA H
Sbjct: 271 ITFQDIWLLRDPLEFDVKYQASAQPFLILGMLVTALAIGH 310
[57][TOP]
>UniRef100_A5GRH1 Chlorophyll synthase 33 kD subunit n=1 Tax=Synechococcus sp. RCC307
RepID=A5GRH1_SYNR3
Length = 317
Score = 58.5 bits (140), Expect = 2e-07
Identities = 27/40 (67%), Positives = 33/40 (82%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ + L+DPV +DVKYQASAQPFLV+G+LVTALA H
Sbjct: 271 ITFQDIWLLRDPVAFDVKYQASAQPFLVIGMLVTALALGH 310
[58][TOP]
>UniRef100_Q117P5 Chlorophyll synthase n=1 Tax=Trichodesmium erythraeum IMS101
RepID=Q117P5_TRIEI
Length = 326
Score = 58.2 bits (139), Expect = 3e-07
Identities = 26/40 (65%), Positives = 33/40 (82%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ YFL++P++ DVKYQASAQPFLVLG+L+T LA H
Sbjct: 284 ITFQDMYFLRNPLENDVKYQASAQPFLVLGMLITGLALGH 323
[59][TOP]
>UniRef100_B7K7B6 Chlorophyll synthase, ChlG n=1 Tax=Cyanothece sp. PCC 7424
RepID=B7K7B6_CYAP7
Length = 318
Score = 57.4 bits (137), Expect = 5e-07
Identities = 27/40 (67%), Positives = 32/40 (80%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ YFL+ P++ DVKYQASAQPFLVLG+LVT LA H
Sbjct: 276 ITFQDMYFLRAPLENDVKYQASAQPFLVLGMLVTGLALGH 315
[60][TOP]
>UniRef100_B7JXU5 Chlorophyll synthase, ChlG n=1 Tax=Cyanothece sp. PCC 8801
RepID=B7JXU5_CYAP8
Length = 326
Score = 57.4 bits (137), Expect = 5e-07
Identities = 27/37 (72%), Positives = 31/37 (83%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALA 293
+ FQ YFL+DP+K DVKYQASAQPFLVLG+LV LA
Sbjct: 284 ITFQDMYFLRDPLKNDVKYQASAQPFLVLGMLVAGLA 320
[61][TOP]
>UniRef100_C7QVT2 Chlorophyll synthase, ChlG n=1 Tax=Cyanothece sp. PCC 8802
RepID=C7QVT2_CYAP0
Length = 326
Score = 57.4 bits (137), Expect = 5e-07
Identities = 27/37 (72%), Positives = 31/37 (83%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALA 293
+ FQ YFL+DP+K DVKYQASAQPFLVLG+LV LA
Sbjct: 284 ITFQDMYFLRDPLKNDVKYQASAQPFLVLGMLVAGLA 320
[62][TOP]
>UniRef100_Q4CB29 Bacteriochlorophyll/chlorophyll synthetase n=1 Tax=Crocosphaera
watsonii WH 8501 RepID=Q4CB29_CROWT
Length = 326
Score = 56.6 bits (135), Expect = 8e-07
Identities = 26/40 (65%), Positives = 32/40 (80%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ YFL++P++ DVKYQASAQPFLVLG+LV LA H
Sbjct: 284 ITFQDMYFLRNPLENDVKYQASAQPFLVLGMLVAGLALGH 323
[63][TOP]
>UniRef100_A0YMU2 Bacteriochlorophyll a synthase n=1 Tax=Lyngbya sp. PCC 8106
RepID=A0YMU2_9CYAN
Length = 332
Score = 56.6 bits (135), Expect = 8e-07
Identities = 26/40 (65%), Positives = 32/40 (80%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ YFL++P++ DVKYQASAQPFLVLG+LV LA H
Sbjct: 291 ITFQDMYFLRNPLENDVKYQASAQPFLVLGMLVVGLALGH 330
[64][TOP]
>UniRef100_B4VXF2 Chlorophyll synthase, ChlG n=1 Tax=Microcoleus chthonoplastes PCC
7420 RepID=B4VXF2_9CYAN
Length = 326
Score = 56.2 bits (134), Expect = 1e-06
Identities = 26/40 (65%), Positives = 31/40 (77%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ YFL+ P++ DVKYQASAQPFLVLG+LV LA H
Sbjct: 284 ITFQDMYFLRSPLENDVKYQASAQPFLVLGMLVAGLALGH 323
[65][TOP]
>UniRef100_B4B6K4 Chlorophyll synthase, ChlG n=1 Tax=Cyanothece sp. PCC 7822
RepID=B4B6K4_9CHRO
Length = 334
Score = 56.2 bits (134), Expect = 1e-06
Identities = 26/40 (65%), Positives = 31/40 (77%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ YFL+ P++ DVKYQASAQPFLVLG+LV LA H
Sbjct: 292 ITFQDMYFLRSPLENDVKYQASAQPFLVLGMLVAGLALGH 331
[66][TOP]
>UniRef100_B5W690 Chlorophyll synthase, ChlG n=1 Tax=Arthrospira maxima CS-328
RepID=B5W690_SPIMA
Length = 330
Score = 55.8 bits (133), Expect = 1e-06
Identities = 25/40 (62%), Positives = 32/40 (80%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ YF+++P++ DVKYQASAQPFLVLG+LV LA H
Sbjct: 289 ITFQDMYFIRNPLENDVKYQASAQPFLVLGMLVVGLALGH 328
[67][TOP]
>UniRef100_A3INF5 Chlorophyll a synthase n=1 Tax=Cyanothece sp. CCY0110
RepID=A3INF5_9CHRO
Length = 326
Score = 55.8 bits (133), Expect = 1e-06
Identities = 26/37 (70%), Positives = 31/37 (83%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALA 293
+ FQ YFL+DP++ DVKYQASAQPFLVLG+LV LA
Sbjct: 284 ITFQDMYFLRDPLENDVKYQASAQPFLVLGMLVAGLA 320
[68][TOP]
>UniRef100_Q55145 Chlorophyll a synthase n=1 Tax=Synechocystis sp. PCC 6803
RepID=Q55145_SYNY3
Length = 324
Score = 55.5 bits (132), Expect = 2e-06
Identities = 25/40 (62%), Positives = 31/40 (77%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ YFL++P++ DVKYQASAQPFLV G+L T LA H
Sbjct: 282 ITFQDMYFLRNPLENDVKYQASAQPFLVFGMLATGLALGH 321
[69][TOP]
>UniRef100_Q7V8R0 Chlorophyll synthase 33 kD subunit n=1 Tax=Prochlorococcus marinus
str. MIT 9313 RepID=Q7V8R0_PROMM
Length = 336
Score = 55.1 bits (131), Expect = 2e-06
Identities = 24/40 (60%), Positives = 32/40 (80%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ + L+DP+ +DV+YQ SAQPFL+LG+LVTALA H
Sbjct: 290 ITFQDIWLLRDPLAFDVRYQTSAQPFLILGMLVTALAIGH 329
[70][TOP]
>UniRef100_A2CBE2 Chlorophyll synthase 33 kD subunit n=1 Tax=Prochlorococcus marinus
str. MIT 9303 RepID=A2CBE2_PROM3
Length = 336
Score = 55.1 bits (131), Expect = 2e-06
Identities = 24/40 (60%), Positives = 32/40 (80%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
+ FQ + L+DP+ +DV+YQ SAQPFL+LG+LVTALA H
Sbjct: 290 ITFQDIWLLRDPLAFDVRYQTSAQPFLILGMLVTALAIGH 329
[71][TOP]
>UniRef100_B7G006 Predicted protein n=1 Tax=Phaeodactylum tricornutum CCAP 1055/1
RepID=B7G006_PHATR
Length = 423
Score = 53.5 bits (127), Expect = 7e-06
Identities = 25/40 (62%), Positives = 29/40 (72%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 284
++FQ L DPV+ DVKYQASAQPFLV G+L TAL H
Sbjct: 379 MYFQATLLLPDPVENDVKYQASAQPFLVFGILATALCIGH 418
[72][TOP]
>UniRef100_Q2JST6 Chlorophyll synthase, ChlG n=1 Tax=Synechococcus sp. JA-3-3Ab
RepID=Q2JST6_SYNJA
Length = 306
Score = 53.1 bits (126), Expect = 9e-06
Identities = 25/37 (67%), Positives = 29/37 (78%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALA 293
+ FQ Y L+DP+ DVKYQASAQPFLVLG+LV LA
Sbjct: 263 ITFQDMYLLRDPLNNDVKYQASAQPFLVLGMLVVGLA 299
[73][TOP]
>UniRef100_Q2JNX7 Chlorophyll synthase, ChlG n=1 Tax=Synechococcus sp.
JA-2-3B'a(2-13) RepID=Q2JNX7_SYNJB
Length = 306
Score = 53.1 bits (126), Expect = 9e-06
Identities = 25/37 (67%), Positives = 29/37 (78%)
Frame = -2
Query: 403 VFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALA 293
+ FQ Y L+DP+ DVKYQASAQPFLVLG+LV LA
Sbjct: 263 ITFQDMYLLRDPLNNDVKYQASAQPFLVLGMLVVGLA 299