[UP]
[1][TOP] >UniRef100_C6T7I7 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T7I7_SOYBN Length = 222 Score = 89.0 bits (219), Expect = 2e-16 Identities = 40/44 (90%), Positives = 44/44 (100%) Frame = -2 Query: 482 PENLHLPSPLSTVGEYEVPLRLPRSIPLPEGKVNWSLQVKVRSK 351 P+NLHLPSPLST+GEYEVPLR+PRSIPLPEGKVNWSL+VKVRSK Sbjct: 179 PDNLHLPSPLSTLGEYEVPLRIPRSIPLPEGKVNWSLKVKVRSK 222 [2][TOP] >UniRef100_C6TKA9 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TKA9_SOYBN Length = 150 Score = 88.2 bits (217), Expect = 3e-16 Identities = 39/44 (88%), Positives = 44/44 (100%) Frame = -2 Query: 482 PENLHLPSPLSTVGEYEVPLRLPRSIPLPEGKVNWSLQVKVRSK 351 P+NLHLPSPL+T+GEYEVPLRLPRSIPLPEGKVNWSL+VK+RSK Sbjct: 107 PDNLHLPSPLATLGEYEVPLRLPRSIPLPEGKVNWSLKVKIRSK 150 [3][TOP] >UniRef100_A7QF16 Chromosome chr16 scaffold_86, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QF16_VITVI Length = 217 Score = 77.8 bits (190), Expect = 3e-13 Identities = 34/44 (77%), Positives = 41/44 (93%) Frame = -2 Query: 482 PENLHLPSPLSTVGEYEVPLRLPRSIPLPEGKVNWSLQVKVRSK 351 PE+LHLPSPL+ VGE+EVPLRLP+SIPLPEGKV W+L+VK+R K Sbjct: 174 PESLHLPSPLTHVGEFEVPLRLPKSIPLPEGKVRWTLKVKIRCK 217 [4][TOP] >UniRef100_B9I1X9 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9I1X9_POPTR Length = 219 Score = 77.4 bits (189), Expect = 5e-13 Identities = 32/44 (72%), Positives = 40/44 (90%) Frame = -2 Query: 482 PENLHLPSPLSTVGEYEVPLRLPRSIPLPEGKVNWSLQVKVRSK 351 P+N+HLPSPL+ +GE+EVPLR P+SIPLPEGKV W+LQVK+R K Sbjct: 176 PDNVHLPSPLTALGEFEVPLRFPKSIPLPEGKVKWTLQVKIRGK 219 [5][TOP] >UniRef100_B9NA71 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NA71_POPTR Length = 219 Score = 75.9 bits (185), Expect = 1e-12 Identities = 31/44 (70%), Positives = 40/44 (90%) Frame = -2 Query: 482 PENLHLPSPLSTVGEYEVPLRLPRSIPLPEGKVNWSLQVKVRSK 351 P+N+HLPSPL+ +GE+EVPLR P+SIPLPEGKV W+L+VK+R K Sbjct: 176 PDNVHLPSPLTALGEFEVPLRFPKSIPLPEGKVKWTLKVKIRGK 219 [6][TOP] >UniRef100_B9P5U5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9P5U5_POPTR Length = 219 Score = 75.1 bits (183), Expect = 2e-12 Identities = 30/44 (68%), Positives = 40/44 (90%) Frame = -2 Query: 482 PENLHLPSPLSTVGEYEVPLRLPRSIPLPEGKVNWSLQVKVRSK 351 P+N+HLPSPL+ +GE+EVPLR P+SIP+PEGKV W+L+VK+R K Sbjct: 176 PDNVHLPSPLTALGEFEVPLRFPKSIPMPEGKVKWTLKVKIRGK 219 [7][TOP] >UniRef100_Q65XC5 Os05g0528900 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q65XC5_ORYSJ Length = 206 Score = 72.8 bits (177), Expect = 1e-11 Identities = 30/44 (68%), Positives = 39/44 (88%) Frame = -2 Query: 482 PENLHLPSPLSTVGEYEVPLRLPRSIPLPEGKVNWSLQVKVRSK 351 P+NLHLPSPL+++GE+E+PLRLPR IP PEGK+ W+L VK+R K Sbjct: 163 PDNLHLPSPLASLGEFELPLRLPRDIPRPEGKLQWTLTVKIRRK 206 [8][TOP] >UniRef100_B8B068 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8B068_ORYSI Length = 206 Score = 72.8 bits (177), Expect = 1e-11 Identities = 30/44 (68%), Positives = 39/44 (88%) Frame = -2 Query: 482 PENLHLPSPLSTVGEYEVPLRLPRSIPLPEGKVNWSLQVKVRSK 351 P+NLHLPSPL+++GE+E+PLRLPR IP PEGK+ W+L VK+R K Sbjct: 163 PDNLHLPSPLASLGEFELPLRLPRDIPRPEGKLQWTLTVKIRRK 206 [9][TOP] >UniRef100_B6T3L4 Ribosomal protein L9, N-terminal domain containing protein n=1 Tax=Zea mays RepID=B6T3L4_MAIZE Length = 203 Score = 70.9 bits (172), Expect = 4e-11 Identities = 29/44 (65%), Positives = 40/44 (90%) Frame = -2 Query: 482 PENLHLPSPLSTVGEYEVPLRLPRSIPLPEGKVNWSLQVKVRSK 351 PENLHL SPL+++GE+E+PLRLP++IP PEGK+ W+L+VK+R K Sbjct: 160 PENLHLQSPLASLGEFELPLRLPQNIPCPEGKLQWTLKVKIRRK 203 [10][TOP] >UniRef100_C0PBI8 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0PBI8_MAIZE Length = 203 Score = 70.5 bits (171), Expect = 6e-11 Identities = 29/44 (65%), Positives = 40/44 (90%) Frame = -2 Query: 482 PENLHLPSPLSTVGEYEVPLRLPRSIPLPEGKVNWSLQVKVRSK 351 PENLHL SPL+++GE+E+PLRLP++IP PEGK+ W+L+VK+R K Sbjct: 160 PENLHLHSPLASLGEFELPLRLPQNIPCPEGKLQWTLKVKIRRK 203 [11][TOP] >UniRef100_C5YJC3 Putative uncharacterized protein Sb07g028700 n=1 Tax=Sorghum bicolor RepID=C5YJC3_SORBI Length = 203 Score = 70.1 bits (170), Expect = 7e-11 Identities = 29/44 (65%), Positives = 39/44 (88%) Frame = -2 Query: 482 PENLHLPSPLSTVGEYEVPLRLPRSIPLPEGKVNWSLQVKVRSK 351 PENLHL SPL+++GE+E+PLRLP+ IP PEGK+ W+L+VK+R K Sbjct: 160 PENLHLQSPLASLGEFELPLRLPQDIPRPEGKLQWTLKVKIRRK 203 [12][TOP] >UniRef100_B9S7H0 Structural constituent of ribosome, putative n=1 Tax=Ricinus communis RepID=B9S7H0_RICCO Length = 225 Score = 68.9 bits (167), Expect = 2e-10 Identities = 28/42 (66%), Positives = 38/42 (90%) Frame = -2 Query: 482 PENLHLPSPLSTVGEYEVPLRLPRSIPLPEGKVNWSLQVKVR 357 P+NLHLP+PL+T GE+ V LR P+SIPLPEGKV+W+L++K+R Sbjct: 182 PDNLHLPAPLTTFGEHYVQLRFPKSIPLPEGKVSWTLKIKIR 223 [13][TOP] >UniRef100_Q9LVU5 Similarity to ribosomal protein L9 n=1 Tax=Arabidopsis thaliana RepID=Q9LVU5_ARATH Length = 221 Score = 61.2 bits (147), Expect = 3e-08 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = -2 Query: 482 PENLHLPSPLSTVGEYEVPLRLPRSIPLPEGKVNWSLQVKVR 357 P+N+ L +PL T GEYEVPL+ P++IPLP+G V W L+VKVR Sbjct: 178 PDNVVLAAPLETFGEYEVPLKFPKTIPLPQGTVQWILKVKVR 219