[UP]
[1][TOP]
>UniRef100_A9TB59 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens
RepID=A9TB59_PHYPA
Length = 589
Score = 52.4 bits (124), Expect(2) = 5e-09
Identities = 28/41 (68%), Positives = 32/41 (78%)
Frame = -3
Query: 300 VIGIN*LSQSLLPPLAELAEDRHLRVWLAITVHIPLLAKPI 178
VIGI+ LSQSLLP + ELAEDRH RV LAI +IPLLA +
Sbjct: 391 VIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQL 431
Score = 31.6 bits (70), Expect(2) = 5e-09
Identities = 12/16 (75%), Positives = 13/16 (81%)
Frame = -1
Query: 176 LGALCMQWLLDQAYEV 129
LGALCMQWL DQ Y +
Sbjct: 440 LGALCMQWLEDQVYSI 455
[2][TOP]
>UniRef100_A9TEJ4 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens
RepID=A9TEJ4_PHYPA
Length = 589
Score = 52.4 bits (124), Expect(2) = 6e-09
Identities = 28/41 (68%), Positives = 32/41 (78%)
Frame = -3
Query: 300 VIGIN*LSQSLLPPLAELAEDRHLRVWLAITVHIPLLAKPI 178
VIGI+ LSQSLLP + ELAEDRH RV LAI +IPLLA +
Sbjct: 391 VIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQL 431
Score = 31.2 bits (69), Expect(2) = 6e-09
Identities = 12/16 (75%), Positives = 13/16 (81%)
Frame = -1
Query: 176 LGALCMQWLLDQAYEV 129
LGALCMQWL DQ Y +
Sbjct: 440 LGALCMQWLGDQVYSI 455
[3][TOP]
>UniRef100_Q9FVD6 Ser/Thr specific protein phosphatase 2A A regulatory subunit beta
isoform n=1 Tax=Medicago sativa subsp. x varia
RepID=Q9FVD6_MEDVA
Length = 587
Score = 52.4 bits (124), Expect(2) = 1e-08
Identities = 28/41 (68%), Positives = 32/41 (78%)
Frame = -3
Query: 300 VIGIN*LSQSLLPPLAELAEDRHLRVWLAITVHIPLLAKPI 178
VIGI+ LSQSLLP + ELAEDRH RV LAI +IPLLA +
Sbjct: 388 VIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQL 428
Score = 30.4 bits (67), Expect(2) = 1e-08
Identities = 11/16 (68%), Positives = 13/16 (81%)
Frame = -1
Query: 176 LGALCMQWLLDQAYEV 129
LGALCMQWL D+ Y +
Sbjct: 437 LGALCMQWLKDKVYSI 452
[4][TOP]
>UniRef100_B9ST19 Serine/threonine protein phosphatase 2a regulatory subunit A,
putative n=1 Tax=Ricinus communis RepID=B9ST19_RICCO
Length = 587
Score = 52.4 bits (124), Expect(2) = 1e-08
Identities = 28/41 (68%), Positives = 32/41 (78%)
Frame = -3
Query: 300 VIGIN*LSQSLLPPLAELAEDRHLRVWLAITVHIPLLAKPI 178
VIGI+ LSQSLLP + ELAEDRH RV LAI +IPLLA +
Sbjct: 388 VIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQL 428
Score = 30.4 bits (67), Expect(2) = 1e-08
Identities = 11/16 (68%), Positives = 13/16 (81%)
Frame = -1
Query: 176 LGALCMQWLLDQAYEV 129
LGALCMQWL D+ Y +
Sbjct: 437 LGALCMQWLQDKVYSI 452
[5][TOP]
>UniRef100_B9RE19 Serine/threonine protein phosphatase 2a regulatory subunit A,
putative n=1 Tax=Ricinus communis RepID=B9RE19_RICCO
Length = 587
Score = 52.4 bits (124), Expect(2) = 1e-08
Identities = 28/41 (68%), Positives = 32/41 (78%)
Frame = -3
Query: 300 VIGIN*LSQSLLPPLAELAEDRHLRVWLAITVHIPLLAKPI 178
VIGI+ LSQSLLP + ELAEDRH RV LAI +IPLLA +
Sbjct: 388 VIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQL 428
Score = 30.4 bits (67), Expect(2) = 1e-08
Identities = 11/16 (68%), Positives = 13/16 (81%)
Frame = -1
Query: 176 LGALCMQWLLDQAYEV 129
LGALCMQWL D+ Y +
Sbjct: 437 LGALCMQWLKDKVYSI 452
[6][TOP]
>UniRef100_B9N9V6 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9N9V6_POPTR
Length = 587
Score = 52.4 bits (124), Expect(2) = 1e-08
Identities = 28/41 (68%), Positives = 32/41 (78%)
Frame = -3
Query: 300 VIGIN*LSQSLLPPLAELAEDRHLRVWLAITVHIPLLAKPI 178
VIGI+ LSQSLLP + ELAEDRH RV LAI +IPLLA +
Sbjct: 388 VIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQL 428
Score = 30.4 bits (67), Expect(2) = 1e-08
Identities = 11/16 (68%), Positives = 13/16 (81%)
Frame = -1
Query: 176 LGALCMQWLLDQAYEV 129
LGALCMQWL D+ Y +
Sbjct: 437 LGALCMQWLKDKVYSI 452
[7][TOP]
>UniRef100_A9PCF7 Predicted protein n=1 Tax=Populus trichocarpa RepID=A9PCF7_POPTR
Length = 587
Score = 52.4 bits (124), Expect(2) = 1e-08
Identities = 28/41 (68%), Positives = 32/41 (78%)
Frame = -3
Query: 300 VIGIN*LSQSLLPPLAELAEDRHLRVWLAITVHIPLLAKPI 178
VIGI+ LSQSLLP + ELAEDRH RV LAI +IPLLA +
Sbjct: 388 VIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQL 428
Score = 30.4 bits (67), Expect(2) = 1e-08
Identities = 11/16 (68%), Positives = 13/16 (81%)
Frame = -1
Query: 176 LGALCMQWLLDQAYEV 129
LGALCMQWL D+ Y +
Sbjct: 437 LGALCMQWLQDKVYSI 452
[8][TOP]
>UniRef100_A7PGR7 Chromosome chr17 scaffold_16, whole genome shotgun sequence n=1
Tax=Vitis vinifera RepID=A7PGR7_VITVI
Length = 587
Score = 52.4 bits (124), Expect(2) = 1e-08
Identities = 28/41 (68%), Positives = 32/41 (78%)
Frame = -3
Query: 300 VIGIN*LSQSLLPPLAELAEDRHLRVWLAITVHIPLLAKPI 178
VIGI+ LSQSLLP + ELAEDRH RV LAI +IPLLA +
Sbjct: 388 VIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQL 428
Score = 30.4 bits (67), Expect(2) = 1e-08
Identities = 11/16 (68%), Positives = 13/16 (81%)
Frame = -1
Query: 176 LGALCMQWLLDQAYEV 129
LGALCMQWL D+ Y +
Sbjct: 437 LGALCMQWLKDKVYSI 452
[9][TOP]
>UniRef100_Q40556 Protein phosphatase 2A n=1 Tax=Nicotiana tabacum RepID=Q40556_TOBAC
Length = 586
Score = 52.4 bits (124), Expect(2) = 1e-08
Identities = 28/41 (68%), Positives = 32/41 (78%)
Frame = -3
Query: 300 VIGIN*LSQSLLPPLAELAEDRHLRVWLAITVHIPLLAKPI 178
VIGI+ LSQSLLP + ELAEDRH RV LAI +IPLLA +
Sbjct: 387 VIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQL 427
Score = 30.4 bits (67), Expect(2) = 1e-08
Identities = 11/16 (68%), Positives = 13/16 (81%)
Frame = -1
Query: 176 LGALCMQWLLDQAYEV 129
LGALCMQWL D+ Y +
Sbjct: 436 LGALCMQWLQDKVYSI 451
[10][TOP]
>UniRef100_B9HJ08 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HJ08_POPTR
Length = 586
Score = 52.4 bits (124), Expect(2) = 1e-08
Identities = 28/41 (68%), Positives = 32/41 (78%)
Frame = -3
Query: 300 VIGIN*LSQSLLPPLAELAEDRHLRVWLAITVHIPLLAKPI 178
VIGI+ LSQSLLP + ELAEDRH RV LAI +IPLLA +
Sbjct: 388 VIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQL 428
Score = 30.4 bits (67), Expect(2) = 1e-08
Identities = 11/16 (68%), Positives = 13/16 (81%)
Frame = -1
Query: 176 LGALCMQWLLDQAYEV 129
LGALCMQWL D+ Y +
Sbjct: 437 LGALCMQWLQDKVYSI 452
[11][TOP]
>UniRef100_Q9ZRU5 Protein phosphatase (Fragment) n=1 Tax=Cicer arietinum
RepID=Q9ZRU5_CICAR
Length = 538
Score = 52.4 bits (124), Expect(2) = 1e-08
Identities = 28/41 (68%), Positives = 32/41 (78%)
Frame = -3
Query: 300 VIGIN*LSQSLLPPLAELAEDRHLRVWLAITVHIPLLAKPI 178
VIGI+ LSQSLLP + ELAEDRH RV LAI +IPLLA +
Sbjct: 339 VIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQL 379
Score = 30.4 bits (67), Expect(2) = 1e-08
Identities = 11/16 (68%), Positives = 13/16 (81%)
Frame = -1
Query: 176 LGALCMQWLLDQAYEV 129
LGALCMQWL D+ Y +
Sbjct: 388 LGALCMQWLKDKVYSI 403
[12][TOP]
>UniRef100_C0L8B0 Protein phosphatase 2A regulatory subunit A (Fragment) n=1
Tax=Betula pendula RepID=C0L8B0_BETVE
Length = 511
Score = 52.4 bits (124), Expect(2) = 1e-08
Identities = 28/41 (68%), Positives = 32/41 (78%)
Frame = -3
Query: 300 VIGIN*LSQSLLPPLAELAEDRHLRVWLAITVHIPLLAKPI 178
VIGI+ LSQSLLP + ELAEDRH RV LAI +IPLLA +
Sbjct: 312 VIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQL 352
Score = 30.4 bits (67), Expect(2) = 1e-08
Identities = 11/16 (68%), Positives = 13/16 (81%)
Frame = -1
Query: 176 LGALCMQWLLDQAYEV 129
LGALCMQWL D+ Y +
Sbjct: 361 LGALCMQWLKDKVYSI 376
[13][TOP]
>UniRef100_A6MUT0 Protein phosphatase (Fragment) n=1 Tax=Gossypium hirsutum
RepID=A6MUT0_GOSHI
Length = 245
Score = 52.4 bits (124), Expect(2) = 1e-08
Identities = 28/41 (68%), Positives = 32/41 (78%)
Frame = -3
Query: 300 VIGIN*LSQSLLPPLAELAEDRHLRVWLAITVHIPLLAKPI 178
VIGI+ LSQSLLP + ELAEDRH RV LAI +IPLLA +
Sbjct: 106 VIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQL 146
Score = 30.4 bits (67), Expect(2) = 1e-08
Identities = 11/16 (68%), Positives = 13/16 (81%)
Frame = -1
Query: 176 LGALCMQWLLDQAYEV 129
LGALCMQWL D+ Y +
Sbjct: 155 LGALCMQWLKDKVYSI 170
[14][TOP]
>UniRef100_Q38845 Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A
alpha isoform n=1 Tax=Arabidopsis thaliana
RepID=2AAA_ARATH
Length = 588
Score = 52.0 bits (123), Expect(2) = 1e-08
Identities = 27/41 (65%), Positives = 32/41 (78%)
Frame = -3
Query: 300 VIGIN*LSQSLLPPLAELAEDRHLRVWLAITVHIPLLAKPI 178
VIGI+ LSQSLLP + ELAEDRH RV LAI ++PLLA +
Sbjct: 388 VIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYVPLLASQL 428
Score = 30.4 bits (67), Expect(2) = 1e-08
Identities = 11/16 (68%), Positives = 13/16 (81%)
Frame = -1
Query: 176 LGALCMQWLLDQAYEV 129
LGALCMQWL D+ Y +
Sbjct: 437 LGALCMQWLQDKVYSI 452
[15][TOP]
>UniRef100_Q8L7J9 Protein phosphatase 2A regulatory A subunit (Fragment) n=1
Tax=Lolium perenne RepID=Q8L7J9_LOLPR
Length = 292
Score = 52.4 bits (124), Expect(2) = 1e-08
Identities = 28/41 (68%), Positives = 32/41 (78%)
Frame = -3
Query: 300 VIGIN*LSQSLLPPLAELAEDRHLRVWLAITVHIPLLAKPI 178
VIGI+ LSQSLLP + ELAEDRH RV LAI +IPLLA +
Sbjct: 93 VIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQL 133
Score = 30.0 bits (66), Expect(2) = 1e-08
Identities = 11/16 (68%), Positives = 13/16 (81%)
Frame = -1
Query: 176 LGALCMQWLLDQAYEV 129
LGALCMQWL D+ Y +
Sbjct: 142 LGALCMQWLEDKVYSI 157
[16][TOP]
>UniRef100_A9STM1 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens
RepID=A9STM1_PHYPA
Length = 589
Score = 52.4 bits (124), Expect(2) = 2e-08
Identities = 28/41 (68%), Positives = 32/41 (78%)
Frame = -3
Query: 300 VIGIN*LSQSLLPPLAELAEDRHLRVWLAITVHIPLLAKPI 178
VIGI+ LSQSLLP + ELAEDRH RV LAI +IPLLA +
Sbjct: 391 VIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQL 431
Score = 29.6 bits (65), Expect(2) = 2e-08
Identities = 11/16 (68%), Positives = 13/16 (81%)
Frame = -1
Query: 176 LGALCMQWLLDQAYEV 129
LGALCMQWL DQ + +
Sbjct: 440 LGALCMQWLGDQVFSI 455
[17][TOP]
>UniRef100_Q6K4K9 Os09g0249700 protein n=3 Tax=Oryza sativa RepID=Q6K4K9_ORYSJ
Length = 587
Score = 52.4 bits (124), Expect(2) = 4e-08
Identities = 28/41 (68%), Positives = 32/41 (78%)
Frame = -3
Query: 300 VIGIN*LSQSLLPPLAELAEDRHLRVWLAITVHIPLLAKPI 178
VIGI+ LSQSLLP + ELAEDRH RV LAI +IPLLA +
Sbjct: 388 VIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQL 428
Score = 28.5 bits (62), Expect(2) = 4e-08
Identities = 10/16 (62%), Positives = 13/16 (81%)
Frame = -1
Query: 176 LGALCMQWLLDQAYEV 129
LGALCMQWL D+ + +
Sbjct: 437 LGALCMQWLEDKVFSI 452
[18][TOP]
>UniRef100_Q38951 Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A
gamma isoform n=1 Tax=Arabidopsis thaliana
RepID=2AAG_ARATH
Length = 587
Score = 52.4 bits (124), Expect(2) = 4e-08
Identities = 28/41 (68%), Positives = 32/41 (78%)
Frame = -3
Query: 300 VIGIN*LSQSLLPPLAELAEDRHLRVWLAITVHIPLLAKPI 178
VIGI+ LSQSLLP + ELAEDRH RV LAI +IPLLA +
Sbjct: 388 VIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQL 428
Score = 28.5 bits (62), Expect(2) = 4e-08
Identities = 10/16 (62%), Positives = 13/16 (81%)
Frame = -1
Query: 176 LGALCMQWLLDQAYEV 129
LGALCMQWL D+ + +
Sbjct: 437 LGALCMQWLQDKVHSI 452
[19][TOP]
>UniRef100_Q38950 Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A
beta isoform n=1 Tax=Arabidopsis thaliana
RepID=2AAB_ARATH
Length = 587
Score = 52.4 bits (124), Expect(2) = 4e-08
Identities = 28/41 (68%), Positives = 32/41 (78%)
Frame = -3
Query: 300 VIGIN*LSQSLLPPLAELAEDRHLRVWLAITVHIPLLAKPI 178
VIGI+ LSQSLLP + ELAEDRH RV LAI +IPLLA +
Sbjct: 388 VIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQL 428
Score = 28.5 bits (62), Expect(2) = 4e-08
Identities = 10/16 (62%), Positives = 13/16 (81%)
Frame = -1
Query: 176 LGALCMQWLLDQAYEV 129
LGALCMQWL D+ + +
Sbjct: 437 LGALCMQWLQDKVHSI 452
[20][TOP]
>UniRef100_A7P359 Chromosome chr1 scaffold_5, whole genome shotgun sequence n=2
Tax=Vitis vinifera RepID=A7P359_VITVI
Length = 587
Score = 50.4 bits (119), Expect(2) = 4e-08
Identities = 27/41 (65%), Positives = 31/41 (75%)
Frame = -3
Query: 300 VIGIN*LSQSLLPPLAELAEDRHLRVWLAITVHIPLLAKPI 178
VIG + LSQSLLP + ELAEDRH RV LAI +IPLLA +
Sbjct: 388 VIGTDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQL 428
Score = 30.4 bits (67), Expect(2) = 4e-08
Identities = 11/16 (68%), Positives = 13/16 (81%)
Frame = -1
Query: 176 LGALCMQWLLDQAYEV 129
LGALCMQWL D+ Y +
Sbjct: 437 LGALCMQWLQDKVYSI 452
[21][TOP]
>UniRef100_Q9FVD7 Ser/Thr specific protein phosphatase 2A A regulatory subunit alpha
isoform n=1 Tax=Medicago sativa subsp. x varia
RepID=Q9FVD7_MEDVA
Length = 585
Score = 52.4 bits (124), Expect(2) = 4e-08
Identities = 28/41 (68%), Positives = 32/41 (78%)
Frame = -3
Query: 300 VIGIN*LSQSLLPPLAELAEDRHLRVWLAITVHIPLLAKPI 178
VIGI+ LSQSLLP + ELAEDRH RV LAI +IPLLA +
Sbjct: 386 VIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQL 426
Score = 28.5 bits (62), Expect(2) = 4e-08
Identities = 10/16 (62%), Positives = 13/16 (81%)
Frame = -1
Query: 176 LGALCMQWLLDQAYEV 129
LGALCMQWL D+ + +
Sbjct: 435 LGALCMQWLQDKVHSI 450
[22][TOP]
>UniRef100_Q32SG2 Protein phosphatase 2A regulatory subunit A n=1 Tax=Zea mays
RepID=Q32SG2_MAIZE
Length = 583
Score = 52.4 bits (124), Expect(2) = 4e-08
Identities = 28/41 (68%), Positives = 32/41 (78%)
Frame = -3
Query: 300 VIGIN*LSQSLLPPLAELAEDRHLRVWLAITVHIPLLAKPI 178
VIGI+ LSQSLLP + ELAEDRH RV LAI +IPLLA +
Sbjct: 388 VIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQL 428
Score = 28.5 bits (62), Expect(2) = 4e-08
Identities = 10/16 (62%), Positives = 13/16 (81%)
Frame = -1
Query: 176 LGALCMQWLLDQAYEV 129
LGALCMQWL D+ + +
Sbjct: 437 LGALCMQWLEDKVFSI 452
[23][TOP]
>UniRef100_A5C593 Putative uncharacterized protein n=1 Tax=Vitis vinifera
RepID=A5C593_VITVI
Length = 582
Score = 50.4 bits (119), Expect(2) = 4e-08
Identities = 27/41 (65%), Positives = 31/41 (75%)
Frame = -3
Query: 300 VIGIN*LSQSLLPPLAELAEDRHLRVWLAITVHIPLLAKPI 178
VIG + LSQSLLP + ELAEDRH RV LAI +IPLLA +
Sbjct: 388 VIGTDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQL 428
Score = 30.4 bits (67), Expect(2) = 4e-08
Identities = 11/16 (68%), Positives = 13/16 (81%)
Frame = -1
Query: 176 LGALCMQWLLDQAYEV 129
LGALCMQWL D+ Y +
Sbjct: 437 LGALCMQWLQDKVYSI 452
[24][TOP]
>UniRef100_Q2V3S4 Putative uncharacterized protein At3g25800.2 n=1 Tax=Arabidopsis
thaliana RepID=Q2V3S4_ARATH
Length = 544
Score = 52.4 bits (124), Expect(2) = 4e-08
Identities = 28/41 (68%), Positives = 32/41 (78%)
Frame = -3
Query: 300 VIGIN*LSQSLLPPLAELAEDRHLRVWLAITVHIPLLAKPI 178
VIGI+ LSQSLLP + ELAEDRH RV LAI +IPLLA +
Sbjct: 388 VIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQL 428
Score = 28.5 bits (62), Expect(2) = 4e-08
Identities = 10/16 (62%), Positives = 13/16 (81%)
Frame = -1
Query: 176 LGALCMQWLLDQAYEV 129
LGALCMQWL D+ + +
Sbjct: 437 LGALCMQWLQDKVHSI 452
[25][TOP]
>UniRef100_Q2V4N7 Putative uncharacterized protein At1g13320.2 n=1 Tax=Arabidopsis
thaliana RepID=Q2V4N7_ARATH
Length = 537
Score = 52.4 bits (124), Expect(2) = 4e-08
Identities = 28/41 (68%), Positives = 32/41 (78%)
Frame = -3
Query: 300 VIGIN*LSQSLLPPLAELAEDRHLRVWLAITVHIPLLAKPI 178
VIGI+ LSQSLLP + ELAEDRH RV LAI +IPLLA +
Sbjct: 388 VIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQL 428
Score = 28.5 bits (62), Expect(2) = 4e-08
Identities = 10/16 (62%), Positives = 13/16 (81%)
Frame = -1
Query: 176 LGALCMQWLLDQAYEV 129
LGALCMQWL D+ + +
Sbjct: 437 LGALCMQWLQDKVHSI 452
[26][TOP]
>UniRef100_B6TLT1 Putative uncharacterized protein n=1 Tax=Zea mays
RepID=B6TLT1_MAIZE
Length = 587
Score = 51.2 bits (121), Expect(2) = 9e-08
Identities = 27/41 (65%), Positives = 32/41 (78%)
Frame = -3
Query: 300 VIGIN*LSQSLLPPLAELAEDRHLRVWLAITVHIPLLAKPI 178
VIGI+ LSQSLLP + EL+EDRH RV LAI +IPLLA +
Sbjct: 388 VIGIDLLSQSLLPAIVELSEDRHWRVRLAIIEYIPLLASQL 428
Score = 28.5 bits (62), Expect(2) = 9e-08
Identities = 10/16 (62%), Positives = 13/16 (81%)
Frame = -1
Query: 176 LGALCMQWLLDQAYEV 129
LGALCMQWL D+ + +
Sbjct: 437 LGALCMQWLEDKVFSI 452
[27][TOP]
>UniRef100_B8A349 Putative uncharacterized protein n=1 Tax=Zea mays
RepID=B8A349_MAIZE
Length = 587
Score = 52.4 bits (124), Expect(2) = 1e-07
Identities = 28/41 (68%), Positives = 32/41 (78%)
Frame = -3
Query: 300 VIGIN*LSQSLLPPLAELAEDRHLRVWLAITVHIPLLAKPI 178
VIGI+ LSQSLLP + ELAEDRH RV LAI +IPLLA +
Sbjct: 388 VIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQL 428
Score = 26.9 bits (58), Expect(2) = 1e-07
Identities = 10/16 (62%), Positives = 12/16 (75%)
Frame = -1
Query: 176 LGALCMQWLLDQAYEV 129
LGALCMQWL D+ +
Sbjct: 437 LGALCMQWLEDKVLSI 452
[28][TOP]
>UniRef100_P36875 Protein phosphatase PP2A regulatory subunit A (Fragment) n=1
Tax=Pisum sativum RepID=2AAA_PEA
Length = 395
Score = 52.4 bits (124), Expect(2) = 2e-07
Identities = 28/41 (68%), Positives = 32/41 (78%)
Frame = -3
Query: 300 VIGIN*LSQSLLPPLAELAEDRHLRVWLAITVHIPLLAKPI 178
VIGI+ LSQSLLP + ELAEDRH RV LAI +IPLLA +
Sbjct: 195 VIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQL 235
Score = 26.2 bits (56), Expect(2) = 2e-07
Identities = 10/16 (62%), Positives = 12/16 (75%)
Frame = -1
Query: 176 LGALCMQWLLDQAYEV 129
LGAL MQWL D+ Y +
Sbjct: 244 LGALIMQWLKDKEYSI 259
[29][TOP]
>UniRef100_A7KZQ4 Protein phosphatase 2A 65 kDa regulatory subunit (Fragment) n=1
Tax=Humulus lupulus RepID=A7KZQ4_HUMLU
Length = 334
Score = 52.4 bits (124), Expect(2) = 2e-07
Identities = 28/41 (68%), Positives = 32/41 (78%)
Frame = -3
Query: 300 VIGIN*LSQSLLPPLAELAEDRHLRVWLAITVHIPLLAKPI 178
VIGI+ LSQSLLP + ELAEDRH RV LAI +IPLLA +
Sbjct: 251 VIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQL 291
Score = 25.8 bits (55), Expect(2) = 2e-07
Identities = 9/15 (60%), Positives = 11/15 (73%)
Frame = -1
Query: 173 GALCMQWLLDQAYEV 129
GALCMQWL D+ +
Sbjct: 301 GALCMQWLQDKVQSI 315