[UP]
[1][TOP]
>UniRef100_Q8VWI0 AT3g06940/F17A9_9 n=2 Tax=Arabidopsis thaliana RepID=Q8VWI0_ARATH
Length = 749
Score = 62.8 bits (151), Expect = 1e-08
Identities = 27/33 (81%), Positives = 30/33 (90%)
Frame = -1
Query: 459 RPKMKPVESIDMIKRQLQCSKCKELGHNKKTCK 361
RPK+K VE +DM+KRQLQCSKCK LGHNKKTCK
Sbjct: 715 RPKIKKVEPLDMMKRQLQCSKCKGLGHNKKTCK 747
[2][TOP]
>UniRef100_Q56Z46 Putative mudrA protein (Fragment) n=1 Tax=Arabidopsis thaliana
RepID=Q56Z46_ARATH
Length = 177
Score = 62.8 bits (151), Expect = 1e-08
Identities = 27/33 (81%), Positives = 30/33 (90%)
Frame = -1
Query: 459 RPKMKPVESIDMIKRQLQCSKCKELGHNKKTCK 361
RPK+K VE +DM+KRQLQCSKCK LGHNKKTCK
Sbjct: 143 RPKIKKVEPLDMMKRQLQCSKCKGLGHNKKTCK 175
[3][TOP]
>UniRef100_UPI00019831D8 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
RepID=UPI00019831D8
Length = 746
Score = 60.1 bits (144), Expect = 8e-08
Identities = 26/34 (76%), Positives = 29/34 (85%)
Frame = -1
Query: 459 RPKMKPVESIDMIKRQLQCSKCKELGHNKKTCKN 358
RPKMK S++ IKRQLQCSKCK LGHNKKTCK+
Sbjct: 712 RPKMKQAGSVETIKRQLQCSKCKGLGHNKKTCKD 745
[4][TOP]
>UniRef100_Q9FI74 Mutator-like transposase-like protein n=1 Tax=Arabidopsis thaliana
RepID=Q9FI74_ARATH
Length = 757
Score = 59.7 bits (143), Expect = 1e-07
Identities = 26/33 (78%), Positives = 27/33 (81%)
Frame = -1
Query: 459 RPKMKPVESIDMIKRQLQCSKCKELGHNKKTCK 361
RPK K VE +DM KRQLQCS CK LGHNKKTCK
Sbjct: 722 RPKSKQVEPLDMFKRQLQCSNCKGLGHNKKTCK 754
[5][TOP]
>UniRef100_B9HMQ9 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HMQ9_POPTR
Length = 222
Score = 55.1 bits (131), Expect = 2e-06
Identities = 24/33 (72%), Positives = 27/33 (81%)
Frame = -1
Query: 453 KMKPVESIDMIKRQLQCSKCKELGHNKKTCKNS 355
++ ES D+IKRQLQCSKCK LGHNKKTCK S
Sbjct: 190 RLSYAESTDIIKRQLQCSKCKGLGHNKKTCKES 222