[UP]
[1][TOP]
>UniRef100_Q76KV9 Polygalacturonase inhibiting protein (Fragment) n=1 Tax=Pisum
sativum RepID=Q76KV9_PEA
Length = 189
Score = 63.5 bits (153), Expect = 7e-09
Identities = 30/48 (62%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
Frame = -2
Query: 218 VPNLQPFHVSYNLLSGKIPPGGELGK-FDKFSYFHYQNLCGTPPPNCQ 78
V NLQ F+VSYN LSG+IP GGEL K FD ++YFH + LCG+P P C+
Sbjct: 141 VENLQQFNVSYNRLSGQIPQGGELQKRFDVYAYFHNKGLCGSPLPACK 188
[2][TOP]
>UniRef100_Q4PJV6 Polygalacturonase inhibiting protein (Fragment) n=1 Tax=Ulmus
pumila RepID=Q4PJV6_9ROSA
Length = 277
Score = 60.5 bits (145), Expect = 6e-08
Identities = 27/45 (60%), Positives = 33/45 (73%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
NLQ F+VSYN L G+IP GG+L FD SYFH + LCG P P+C+
Sbjct: 233 NLQGFNVSYNRLCGEIPAGGKLQSFDDTSYFHNRCLCGAPLPSCK 277
[3][TOP]
>UniRef100_B2CFL2 Polygalacturonase inhibiting protein 1 n=1 Tax=Chorispora bungeana
RepID=B2CFL2_CHOBU
Length = 332
Score = 59.7 bits (143), Expect = 1e-07
Identities = 26/44 (59%), Positives = 33/44 (75%)
Frame = -2
Query: 209 LQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
LQ F+VSYN+L G+IP GG L KFD +SYFH + LCG P +C+
Sbjct: 289 LQFFNVSYNILCGRIPNGGNLQKFDSYSYFHNKCLCGAPLDSCK 332
[4][TOP]
>UniRef100_A7Y2Y8 Polygalacturonase-inhibiting protein n=1 Tax=Fragaria x ananassa
RepID=A7Y2Y8_FRAAN
Length = 332
Score = 59.3 bits (142), Expect = 1e-07
Identities = 27/44 (61%), Positives = 32/44 (72%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNC 81
NLQ F+VSYN L G+IP GG+L FD SYFH + LCG P P+C
Sbjct: 289 NLQLFNVSYNRLCGQIPVGGKLQSFDTTSYFHNRCLCGAPLPSC 332
[5][TOP]
>UniRef100_B2CZJ2 PGIP n=1 Tax=Capsicum annuum RepID=B2CZJ2_CAPAN
Length = 265
Score = 58.9 bits (141), Expect = 2e-07
Identities = 25/43 (58%), Positives = 32/43 (74%)
Frame = -2
Query: 206 QPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
Q F+VSYN L GKIP GG + +FD++SYFH + LCG P P C+
Sbjct: 223 QLFNVSYNSLCGKIPQGGSMQRFDQYSYFHNKCLCGAPLPPCK 265
[6][TOP]
>UniRef100_Q7XBG7 Polygalacturonase-inhibiting protein n=1 Tax=Pyrus pyrifolia
RepID=Q7XBG7_PYRPY
Length = 330
Score = 58.2 bits (139), Expect = 3e-07
Identities = 25/45 (55%), Positives = 33/45 (73%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
N Q +VSYN L G+IP GG+L FD++SYFH + LCG P P+C+
Sbjct: 286 NFQFLNVSYNRLCGQIPVGGKLQSFDEYSYFHNRCLCGAPLPSCK 330
[7][TOP]
>UniRef100_Q7XBG6 Polygalacturonase-inhibiting protein n=1 Tax=Pyrus hybrid cultivar
RepID=Q7XBG6_9ROSA
Length = 330
Score = 58.2 bits (139), Expect = 3e-07
Identities = 25/45 (55%), Positives = 33/45 (73%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
N Q +VSYN L G+IP GG+L FD++SYFH + LCG P P+C+
Sbjct: 286 NFQFLNVSYNRLCGQIPVGGKLQSFDEYSYFHNRCLCGAPLPSCK 330
[8][TOP]
>UniRef100_Q7XBG5 Polygalacturonase-inhibiting protein n=1 Tax=Pyrus communis
RepID=Q7XBG5_PYRCO
Length = 330
Score = 58.2 bits (139), Expect = 3e-07
Identities = 25/45 (55%), Positives = 33/45 (73%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
N Q +VSYN L G+IP GG+L FD++SYFH + LCG P P+C+
Sbjct: 286 NFQFLNVSYNRLCGQIPVGGKLQSFDEYSYFHNRCLCGAPLPSCK 330
[9][TOP]
>UniRef100_P93270 Polygalacturonase-inhibiting protein n=1 Tax=Malus x domestica
RepID=P93270_MALDO
Length = 330
Score = 58.2 bits (139), Expect = 3e-07
Identities = 25/45 (55%), Positives = 33/45 (73%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
N Q +VSYN L G+IP GG+L FD++SYFH + LCG P P+C+
Sbjct: 286 NFQFLNVSYNRLCGQIPVGGKLQSFDEYSYFHNRCLCGAPLPSCK 330
[10][TOP]
>UniRef100_B9T2C7 Serine-threonine protein kinase, plant-type, putative n=1
Tax=Ricinus communis RepID=B9T2C7_RICCO
Length = 328
Score = 58.2 bits (139), Expect = 3e-07
Identities = 26/44 (59%), Positives = 31/44 (70%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNC 81
NL F+VSYN L G+IP GG+L KFD +YFH + LCG P NC
Sbjct: 283 NLSSFNVSYNRLCGQIPNGGQLQKFDTTTYFHNRCLCGAPLKNC 326
[11][TOP]
>UniRef100_B7U8J0 Polygalacturonase-inhibiting protein n=1 Tax=Malus hupehensis
RepID=B7U8J0_9ROSA
Length = 330
Score = 58.2 bits (139), Expect = 3e-07
Identities = 25/45 (55%), Positives = 33/45 (73%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
N Q +VSYN L G+IP GG+L FD++SYFH + LCG P P+C+
Sbjct: 286 NFQFLNVSYNRLCGQIPVGGKLQSFDEYSYFHNRCLCGAPLPSCK 330
[12][TOP]
>UniRef100_A7XZV2 Polygalacturonase-inhibiting protein n=1 Tax=Pyrus ussuriensis
RepID=A7XZV2_9ROSA
Length = 330
Score = 58.2 bits (139), Expect = 3e-07
Identities = 25/45 (55%), Positives = 33/45 (73%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
N Q +VSYN L G+IP GG+L FD++SYFH + LCG P P+C+
Sbjct: 286 NFQFLNVSYNRLCGQIPVGGKLQSFDEYSYFHNRCLCGAPLPSCK 330
[13][TOP]
>UniRef100_Q05091 Polygalacturonase inhibitor n=2 Tax=Pyrus RepID=PGIP_PYRCO
Length = 330
Score = 58.2 bits (139), Expect = 3e-07
Identities = 25/45 (55%), Positives = 33/45 (73%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
N Q +VSYN L G+IP GG+L FD++SYFH + LCG P P+C+
Sbjct: 286 NFQFLNVSYNRLCGQIPVGGKLQSFDEYSYFHNRCLCGAPLPSCK 330
[14][TOP]
>UniRef100_C4PG28 Polygalacturonase inhibiting protein n=1 Tax=Solanum torvum
RepID=C4PG28_9SOLN
Length = 329
Score = 57.8 bits (138), Expect = 4e-07
Identities = 25/44 (56%), Positives = 33/44 (75%)
Frame = -2
Query: 209 LQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
LQ +VSYN L G+IP GG+L FD +SYFH + LCG+P P+C+
Sbjct: 286 LQYLNVSYNRLCGQIPQGGKLQSFDVYSYFHNKCLCGSPVPDCK 329
[15][TOP]
>UniRef100_C3VX46 Polygalacturonase-inhibiting protein 1 n=1 Tax=Brassica rapa subsp.
pekinensis RepID=C3VX46_BRARP
Length = 342
Score = 57.8 bits (138), Expect = 4e-07
Identities = 24/44 (54%), Positives = 32/44 (72%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNC 81
+LQ F+VSYN L G+IP GG+L FD ++Y H + LCG P P+C
Sbjct: 283 DLQTFNVSYNRLCGRIPQGGDLQSFDAYAYLHNKCLCGAPLPSC 326
[16][TOP]
>UniRef100_A9YBZ2 Polygalacturonase inhibitor protein 11 n=1 Tax=Brassica napus
RepID=A9YBZ2_BRANA
Length = 342
Score = 57.8 bits (138), Expect = 4e-07
Identities = 24/44 (54%), Positives = 32/44 (72%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNC 81
+LQ F+VSYN L G+IP GG+L FD ++Y H + LCG P P+C
Sbjct: 283 DLQTFNVSYNRLCGRIPQGGDLQSFDAYAYLHNKCLCGAPLPSC 326
[17][TOP]
>UniRef100_A2Q4V4 Leucine-rich repeat, plant specific n=1 Tax=Medicago truncatula
RepID=A2Q4V4_MEDTR
Length = 322
Score = 57.0 bits (136), Expect = 6e-07
Identities = 27/48 (56%), Positives = 34/48 (70%), Gaps = 1/48 (2%)
Frame = -2
Query: 218 VPNLQPFHVSYNLLSGKIPPGGEL-GKFDKFSYFHYQNLCGTPPPNCQ 78
V LQ F+VSYNLL G+IP GG L FD F+Y+H + LCG+P P C+
Sbjct: 275 VKELQMFNVSYNLLCGQIPQGGNLQTNFDVFNYYHNKCLCGSPLPKCK 322
[18][TOP]
>UniRef100_Q3LS01 Polygalacturonase inhibitor (Fragment) n=1 Tax=Solanum palustre
RepID=Q3LS01_SOLBR
Length = 307
Score = 56.6 bits (135), Expect = 8e-07
Identities = 25/44 (56%), Positives = 32/44 (72%)
Frame = -2
Query: 209 LQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
LQ F+VSYN L G+IP GG L FD +SY H + LCG+P P+C+
Sbjct: 264 LQFFNVSYNRLCGQIPQGGTLQSFDAYSYLHNKCLCGSPLPDCK 307
[19][TOP]
>UniRef100_C5YXZ2 Putative uncharacterized protein Sb09g000430 n=1 Tax=Sorghum
bicolor RepID=C5YXZ2_SORBI
Length = 356
Score = 56.6 bits (135), Expect = 8e-07
Identities = 24/43 (55%), Positives = 31/43 (72%)
Frame = -2
Query: 209 LQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNC 81
LQ F+VSYN + G +P GG + KFD +SY H + LCGTP P+C
Sbjct: 309 LQLFNVSYNKMCGVVPTGGNMDKFDAYSYQHNKCLCGTPLPSC 351
[20][TOP]
>UniRef100_B2ZCQ4 Polygalacturonase-inhibiting protein n=1 Tax=Knorringia sibirica
RepID=B2ZCQ4_9CARY
Length = 339
Score = 56.6 bits (135), Expect = 8e-07
Identities = 24/45 (53%), Positives = 33/45 (73%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
N+ F+VSYN L GKIP GG LG+F+K+S+ H + LCG+P C+
Sbjct: 295 NMNNFNVSYNRLCGKIPNGGRLGEFNKYSFIHNKCLCGSPLDACK 339
[21][TOP]
>UniRef100_Q8RVG4 Polygalacturonase inhibiting protein (Fragment) n=1 Tax=Daucus
carota RepID=Q8RVG4_DAUCA
Length = 325
Score = 56.2 bits (134), Expect = 1e-06
Identities = 24/45 (53%), Positives = 33/45 (73%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
++Q F+VSYN L G+IP GG L FD++SY H + LCG+P P C+
Sbjct: 281 HMQFFNVSYNRLCGQIPRGGTLQSFDQYSYLHNKLLCGSPLPKCK 325
[22][TOP]
>UniRef100_Q6BDJ3 Polygalacturonase inhibitor protein (Fragment) n=1 Tax=Solanum
palustre RepID=Q6BDJ3_SOLBR
Length = 307
Score = 56.2 bits (134), Expect = 1e-06
Identities = 25/44 (56%), Positives = 32/44 (72%)
Frame = -2
Query: 209 LQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
LQ F+VSYN L G+IP GG L FD +SY H + LCG+P P+C+
Sbjct: 264 LQFFNVSYNRLCGQIPQGGTLQSFDVYSYLHNKCLCGSPLPDCK 307
[23][TOP]
>UniRef100_Q3LS00 Polygalacturonase inhibitor (Fragment) n=1 Tax=Solanum palustre
RepID=Q3LS00_SOLBR
Length = 307
Score = 56.2 bits (134), Expect = 1e-06
Identities = 25/44 (56%), Positives = 32/44 (72%)
Frame = -2
Query: 209 LQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
LQ F+VSYN L G+IP GG L FD +SY H + LCG+P P+C+
Sbjct: 264 LQFFNVSYNRLCGQIPQGGTLQSFDVYSYLHNKCLCGSPLPDCK 307
[24][TOP]
>UniRef100_A9YBZ8 Polygalacturonase inhibitor protein 17 n=1 Tax=Brassica napus
RepID=A9YBZ8_BRANA
Length = 327
Score = 56.2 bits (134), Expect = 1e-06
Identities = 24/45 (53%), Positives = 33/45 (73%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
+LQ F+VSYN L G+IP GGEL +FD ++Y H + LCG P +C+
Sbjct: 283 DLQIFNVSYNRLCGRIPQGGELQRFDAYAYLHNKCLCGAPLQSCK 327
[25][TOP]
>UniRef100_A9YBZ5 Polygalacturonase inhibitor protein 14 n=1 Tax=Brassica napus
RepID=A9YBZ5_BRANA
Length = 327
Score = 56.2 bits (134), Expect = 1e-06
Identities = 24/45 (53%), Positives = 33/45 (73%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
+LQ F+VSYN L G+IP GGEL +FD ++Y H + LCG P +C+
Sbjct: 283 DLQIFNVSYNRLCGRIPQGGELQRFDAYAYLHNKCLCGAPLQSCK 327
[26][TOP]
>UniRef100_A9YBZ4 Polygalacturonase inhibitor protein 13 n=1 Tax=Brassica napus
RepID=A9YBZ4_BRANA
Length = 330
Score = 56.2 bits (134), Expect = 1e-06
Identities = 24/45 (53%), Positives = 33/45 (73%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
+LQ F+VSYN L G+IP GGEL +FD ++Y H + LCG P +C+
Sbjct: 286 DLQIFNVSYNRLCGRIPQGGELQRFDAYAYLHNKCLCGAPLQSCK 330
[27][TOP]
>UniRef100_A9YBZ1 Polygalacturonase inhibitor protein 10 n=1 Tax=Brassica napus
RepID=A9YBZ1_BRANA
Length = 330
Score = 56.2 bits (134), Expect = 1e-06
Identities = 24/45 (53%), Positives = 33/45 (73%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
+LQ F+VSYN L G+IP GGEL +FD ++Y H + LCG P +C+
Sbjct: 286 DLQIFNVSYNRLCGRIPQGGELQRFDAYAYLHNKCLCGAPLQSCK 330
[28][TOP]
>UniRef100_A9YBY8 Polygalacturonase inhibitor protein 7 n=1 Tax=Brassica napus
RepID=A9YBY8_BRANA
Length = 327
Score = 56.2 bits (134), Expect = 1e-06
Identities = 24/45 (53%), Positives = 33/45 (73%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
+LQ F+VSYN L G+IP GGEL +FD ++Y H + LCG P +C+
Sbjct: 283 DLQIFNVSYNRLCGRIPQGGELQRFDAYAYLHNKCLCGAPLQSCK 327
[29][TOP]
>UniRef100_Q4PJV7 Polygalacturonase inhibiting protein (Fragment) n=1 Tax=Ulmus
americana RepID=Q4PJV7_ULMAM
Length = 278
Score = 55.8 bits (133), Expect = 1e-06
Identities = 25/44 (56%), Positives = 32/44 (72%)
Frame = -2
Query: 209 LQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
LQ F+VSYN L G+IP GG+L F+ SYFH + LCG P P+C+
Sbjct: 235 LQGFNVSYNRLCGEIPVGGKLQSFNDTSYFHNRCLCGAPLPSCK 278
[30][TOP]
>UniRef100_B9II20 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9II20_POPTR
Length = 327
Score = 55.8 bits (133), Expect = 1e-06
Identities = 24/44 (54%), Positives = 31/44 (70%)
Frame = -2
Query: 209 LQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
LQ ++SYN L G+IP GG+L FD F+YFH + LCG P NC+
Sbjct: 284 LQSLNMSYNRLCGQIPVGGKLQSFDNFTYFHNRCLCGVPLENCK 327
[31][TOP]
>UniRef100_Q8L4C1 Polygalacturonase inhibitor protein n=1 Tax=Brassica napus
RepID=Q8L4C1_BRANA
Length = 342
Score = 55.5 bits (132), Expect = 2e-06
Identities = 23/44 (52%), Positives = 32/44 (72%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNC 81
+LQ F+VSYN L G+IP GG+L +FD ++Y H + LC P P+C
Sbjct: 283 DLQTFNVSYNRLCGRIPQGGDLQRFDVYAYLHNKCLCDAPLPSC 326
[32][TOP]
>UniRef100_Q40160 Polygalacturonase inhibitor protein n=1 Tax=Solanum lycopersicum
RepID=Q40160_SOLLC
Length = 327
Score = 55.5 bits (132), Expect = 2e-06
Identities = 25/44 (56%), Positives = 31/44 (70%)
Frame = -2
Query: 209 LQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
LQ F+VSYN L G+IP GG L FD +SY H + LCG+P P C+
Sbjct: 284 LQFFNVSYNRLCGQIPQGGTLQSFDIYSYLHNKCLCGSPLPKCK 327
[33][TOP]
>UniRef100_A9YBY6 Polygalacturonase inhibitor protein 5 (Fragment) n=1 Tax=Brassica
napus RepID=A9YBY6_BRANA
Length = 331
Score = 55.5 bits (132), Expect = 2e-06
Identities = 25/44 (56%), Positives = 31/44 (70%)
Frame = -2
Query: 209 LQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
LQ F+VSYN L G IP GG L +FD +SYFH + LCG P +C+
Sbjct: 288 LQFFNVSYNRLCGHIPTGGTLQEFDSYSYFHNKCLCGAPLDSCK 331
[34][TOP]
>UniRef100_Q8L579 Polygalacturonase inhibitor protein n=1 Tax=Brassica napus
RepID=Q8L579_BRANA
Length = 331
Score = 55.1 bits (131), Expect = 2e-06
Identities = 25/44 (56%), Positives = 31/44 (70%)
Frame = -2
Query: 209 LQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
LQ F+VSYN L G IP GG L +FD +SYFH + LCG P +C+
Sbjct: 288 LQFFNVSYNRLCGHIPTGGTLQEFDTYSYFHNKCLCGAPLDSCK 331
[35][TOP]
>UniRef100_Q38695 Polygalacturonase inhibitor n=1 Tax=Actinidia deliciosa
RepID=Q38695_ACTDE
Length = 327
Score = 55.1 bits (131), Expect = 2e-06
Identities = 25/45 (55%), Positives = 32/45 (71%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
+LQ +VSYN L G IP GG+L FD+ SYFH + LCG P P+C+
Sbjct: 283 DLQYLNVSYNRLCGHIPTGGKLQGFDQTSYFHNRCLCGAPLPDCK 327
[36][TOP]
>UniRef100_C0LV94 Polygalacturonase-inhibiting protein 2 n=1 Tax=Brassica rapa subsp.
pekinensis RepID=C0LV94_BRARP
Length = 332
Score = 55.1 bits (131), Expect = 2e-06
Identities = 25/44 (56%), Positives = 31/44 (70%)
Frame = -2
Query: 209 LQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
LQ F+VSYN L G IP GG L +FD +SYFH + LCG P +C+
Sbjct: 289 LQFFNVSYNRLCGHIPTGGTLQEFDTYSYFHNKCLCGAPLDSCK 332
[37][TOP]
>UniRef100_A2Q4V2 Leucine-rich repeat, plant specific n=1 Tax=Medicago truncatula
RepID=A2Q4V2_MEDTR
Length = 342
Score = 55.1 bits (131), Expect = 2e-06
Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 3/50 (6%)
Frame = -2
Query: 218 VPNLQPFHVSYNLLSGKIPPGGE---LGKFDKFSYFHYQNLCGTPPPNCQ 78
V NLQ F+VSYN LSG+IP GG +FD ++Y H + LCG P P C+
Sbjct: 293 VENLQQFNVSYNKLSGEIPQGGTGRLQDRFDVYAYLHNKGLCGPPLPKCK 342
[38][TOP]
>UniRef100_Q9LKQ8 Polygalacturonase inhibiting protein n=1 Tax=Prunus mahaleb
RepID=Q9LKQ8_9ROSA
Length = 330
Score = 54.3 bits (129), Expect = 4e-06
Identities = 24/45 (53%), Positives = 32/45 (71%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
+LQ +VSYN L G+IP GG+L FD +YFH + LCG P P+C+
Sbjct: 286 DLQFLNVSYNRLCGQIPVGGKLQSFDSSTYFHNRCLCGAPLPSCK 330
[39][TOP]
>UniRef100_Q704Z8 Putative polygalacturonase-inhibiting protein n=1 Tax=Rubus idaeus
RepID=Q704Z8_RUBID
Length = 331
Score = 54.3 bits (129), Expect = 4e-06
Identities = 24/41 (58%), Positives = 29/41 (70%)
Frame = -2
Query: 200 FHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
F+VSYN L GKIP GG+L D SYFH + LCG P P+C+
Sbjct: 291 FNVSYNRLCGKIPVGGKLQSLDTTSYFHNRCLCGAPLPSCK 331
[40][TOP]
>UniRef100_Q6V406 Polygalacturonase inhibiting protein n=1 Tax=Prunus persica
RepID=Q6V406_PRUPE
Length = 330
Score = 54.3 bits (129), Expect = 4e-06
Identities = 24/45 (53%), Positives = 32/45 (71%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
+LQ +VSYN L G+IP GG+L FD +YFH + LCG P P+C+
Sbjct: 286 DLQFLNVSYNRLCGQIPVGGKLQSFDSSTYFHNRCLCGAPLPSCK 330
[41][TOP]
>UniRef100_Q5UBV7 Polygalacturonase inhibiting protein n=1 Tax=Prunus mume
RepID=Q5UBV7_PRUMU
Length = 330
Score = 54.3 bits (129), Expect = 4e-06
Identities = 24/45 (53%), Positives = 32/45 (71%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
+LQ +VSYN L G+IP GG+L FD +YFH + LCG P P+C+
Sbjct: 286 DLQFLNVSYNRLCGQIPVGGKLQSFDSSTYFHNRCLCGAPLPSCK 330
[42][TOP]
>UniRef100_Q5FX59 Polygalacturonase-inhibiting protein n=1 Tax=Prunus americana
RepID=Q5FX59_9ROSA
Length = 330
Score = 54.3 bits (129), Expect = 4e-06
Identities = 24/45 (53%), Positives = 32/45 (71%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
+LQ +VSYN L G+IP GG+L FD +YFH + LCG P P+C+
Sbjct: 286 DLQFLNVSYNRLCGQIPVGGKLQSFDSSTYFHNRCLCGAPLPSCK 330
[43][TOP]
>UniRef100_Q5EDH6 Polygalacturonase-inhibiting protein n=1 Tax=Prunus persica
RepID=Q5EDH6_PRUPE
Length = 330
Score = 54.3 bits (129), Expect = 4e-06
Identities = 24/45 (53%), Positives = 32/45 (71%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
+LQ +VSYN L G+IP GG+L FD +YFH + LCG P P+C+
Sbjct: 286 DLQFLNVSYNRLCGQIPVGGKLQSFDSSTYFHNRCLCGAPLPSCK 330
[44][TOP]
>UniRef100_Q5EDH5 Polygalacturonase-inhibiting protein n=1 Tax=Prunus persica
RepID=Q5EDH5_PRUPE
Length = 330
Score = 54.3 bits (129), Expect = 4e-06
Identities = 24/45 (53%), Positives = 32/45 (71%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
+LQ +VSYN L G+IP GG+L FD +YFH + LCG P P+C+
Sbjct: 286 DLQFLNVSYNRLCGQIPVGGKLQSFDSSTYFHNRCLCGAPLPSCK 330
[45][TOP]
>UniRef100_Q5EDH1 Polygalacturonase-inhibiting protein n=1 Tax=Prunus mume
RepID=Q5EDH1_PRUMU
Length = 330
Score = 54.3 bits (129), Expect = 4e-06
Identities = 24/45 (53%), Positives = 32/45 (71%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
+LQ +VSYN L G+IP GG+L FD +YFH + LCG P P+C+
Sbjct: 286 DLQFLNVSYNRLCGQIPVGGKLQSFDSSTYFHNRCLCGAPLPSCK 330
[46][TOP]
>UniRef100_Q4VDA8 Polygalacturonase-inhibiting protein n=1 Tax=Prunus salicina
RepID=Q4VDA8_9ROSA
Length = 330
Score = 54.3 bits (129), Expect = 4e-06
Identities = 24/45 (53%), Positives = 32/45 (71%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
+LQ +VSYN L G+IP GG+L FD +YFH + LCG P P+C+
Sbjct: 286 DLQFLNVSYNRLCGQIPVGGKLQSFDSSTYFHNRCLCGAPLPSCK 330
[47][TOP]
>UniRef100_Q3HRV2 Polygalacturonase inhibiting protein n=1 Tax=Prunus salicina
RepID=Q3HRV2_9ROSA
Length = 330
Score = 54.3 bits (129), Expect = 4e-06
Identities = 24/45 (53%), Positives = 32/45 (71%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
+LQ +VSYN L G+IP GG+L FD +YFH + LCG P P+C+
Sbjct: 286 DLQFLNVSYNRLCGQIPVGGKLQSFDSSTYFHNRCLCGAPLPSCK 330
[48][TOP]
>UniRef100_O22522 Polygalacturonase inhibiting protein n=1 Tax=Prunus armeniaca
RepID=O22522_PRUAR
Length = 330
Score = 54.3 bits (129), Expect = 4e-06
Identities = 24/45 (53%), Positives = 32/45 (71%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
+LQ +VSYN L G+IP GG+L FD +YFH + LCG P P+C+
Sbjct: 286 DLQFLNVSYNRLCGQIPVGGKLQSFDSSTYFHNRCLCGAPLPSCK 330
[49][TOP]
>UniRef100_C3VX47 Polygalacturonase-inhibiting protein 4 n=1 Tax=Brassica rapa subsp.
pekinensis RepID=C3VX47_BRARP
Length = 334
Score = 54.3 bits (129), Expect = 4e-06
Identities = 23/43 (53%), Positives = 31/43 (72%)
Frame = -2
Query: 206 QPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
Q F+VSYN L G+IP GG+L FD ++YFH + LCG P +C+
Sbjct: 292 QIFNVSYNRLCGRIPTGGKLQMFDSYAYFHNKCLCGAPLDSCK 334
[50][TOP]
>UniRef100_B8Y5Z2 Polygalacturonase-inhibiting protein n=1 Tax=Ampelopsis glandulosa
var. brevipedunculata RepID=B8Y5Z2_AMPBE
Length = 330
Score = 54.3 bits (129), Expect = 4e-06
Identities = 24/45 (53%), Positives = 32/45 (71%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
+LQ +VSYN L G+IP GG+L FD +YFH + LCG P P+C+
Sbjct: 286 DLQFLNVSYNRLCGQIPVGGKLQSFDSSNYFHNRCLCGAPLPSCK 330
[51][TOP]
>UniRef100_Q8L9Q0 Polygalacturonase inhibiting protein 1 n=1 Tax=Arabidopsis thaliana
RepID=Q8L9Q0_ARATH
Length = 332
Score = 53.9 bits (128), Expect = 5e-06
Identities = 25/44 (56%), Positives = 30/44 (68%)
Frame = -2
Query: 209 LQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
LQ F+VSYN L G IP GG+L FD +SYFH + LCG P C+
Sbjct: 289 LQFFNVSYNKLCGHIPTGGKLQTFDSYSYFHNKCLCGAPLEICK 332
[52][TOP]
>UniRef100_Q7X9Q7 Polygalacturonase-inhibiting protein n=1 Tax=Cucumis melo
RepID=Q7X9Q7_CUCME
Length = 326
Score = 53.9 bits (128), Expect = 5e-06
Identities = 24/44 (54%), Positives = 31/44 (70%)
Frame = -2
Query: 209 LQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
LQ +VSYN L G+IP GG+L FD +SYFH + LCG P +C+
Sbjct: 283 LQMLNVSYNALCGRIPMGGKLQSFDVYSYFHNKCLCGKPLGSCK 326
[53][TOP]
>UniRef100_Q6B962 Polygalacturonase inhibitor protein (Fragment) n=1 Tax=Carica
papaya RepID=Q6B962_CARPA
Length = 338
Score = 53.9 bits (128), Expect = 5e-06
Identities = 24/47 (51%), Positives = 33/47 (70%)
Frame = -2
Query: 218 VPNLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
+ +LQ +VSYN L G+IP GG+L +FD +YFH + LCG P P C+
Sbjct: 292 IVSLQFLNVSYNRLCGEIPVGGDLQRFDYTAYFHNRCLCGAPLPPCK 338
[54][TOP]
>UniRef100_A7L8C8 PGIP4 n=1 Tax=Populus deltoides RepID=A7L8C8_POPDE
Length = 328
Score = 53.9 bits (128), Expect = 5e-06
Identities = 25/44 (56%), Positives = 30/44 (68%)
Frame = -2
Query: 209 LQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
LQ +VSYN L G+IP GG+L FD SYFH + LCG P NC+
Sbjct: 285 LQSLNVSYNRLCGQIPVGGKLQSFDYSSYFHNRCLCGAPLGNCK 328
[55][TOP]
>UniRef100_A3FKE4 Polygalacturonase inhibiting protein n=1 Tax=Raphanus sativus
RepID=A3FKE4_RAPSA
Length = 323
Score = 53.9 bits (128), Expect = 5e-06
Identities = 24/44 (54%), Positives = 31/44 (70%)
Frame = -2
Query: 209 LQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
LQ +VSYN L G IP GG+L +FD +SYFH + LCG P +C+
Sbjct: 280 LQFLNVSYNRLCGHIPTGGKLQEFDSYSYFHNKCLCGAPLDSCK 323
[56][TOP]
>UniRef100_Q9M5J9 Polygalacturonase inhibitor 1 n=1 Tax=Arabidopsis thaliana
RepID=PGIP1_ARATH
Length = 330
Score = 53.9 bits (128), Expect = 5e-06
Identities = 25/44 (56%), Positives = 30/44 (68%)
Frame = -2
Query: 209 LQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
LQ F+VSYN L G IP GG+L FD +SYFH + LCG P C+
Sbjct: 287 LQFFNVSYNKLCGHIPTGGKLQTFDSYSYFHNKCLCGAPLEICK 330
[57][TOP]
>UniRef100_Q6SYZ2 Polygalacturonase-inhibiting protein n=1 Tax=Eucalyptus grandis
RepID=Q6SYZ2_EUCGR
Length = 331
Score = 53.5 bits (127), Expect = 7e-06
Identities = 24/45 (53%), Positives = 31/45 (68%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
N Q +VSYN L G+IP GG+L FD++SYFH + LCG P C+
Sbjct: 286 NFQFLNVSYNRLCGQIPVGGKLQSFDEYSYFHNRCLCGAPLGPCK 330
[58][TOP]
>UniRef100_A4GRE2 Polygalacturonase inhibiting protein n=1 Tax=Prunus persica
RepID=A4GRE2_PRUPE
Length = 330
Score = 53.5 bits (127), Expect = 7e-06
Identities = 24/45 (53%), Positives = 31/45 (68%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
+LQ +VSYN L G+IP GG+L FD +Y H Q LCG P P+C+
Sbjct: 286 DLQFLNVSYNRLCGQIPVGGKLQSFDSSTYIHNQCLCGAPLPSCK 330
[59][TOP]
>UniRef100_A0MMC8 Polygalacturonase inhibiting protein-like n=1 Tax=Hordeum vulgare
RepID=A0MMC8_HORVU
Length = 347
Score = 53.5 bits (127), Expect = 7e-06
Identities = 22/44 (50%), Positives = 30/44 (68%)
Frame = -2
Query: 218 VPNLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPP 87
V NL F+VSYN L G +P GG + +FD +++ H + LCG PPP
Sbjct: 289 VANLLAFNVSYNRLCGAVPTGGNMARFDLYNFQHNKCLCGAPPP 332
[60][TOP]
>UniRef100_O82438 Antifreeze polypeptide n=1 Tax=Daucus carota RepID=O82438_DAUCA
Length = 332
Score = 53.1 bits (126), Expect = 9e-06
Identities = 24/44 (54%), Positives = 29/44 (65%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNC 81
+LQ F+VS N L GKIP GG L +FD+ +Y H LCG P P C
Sbjct: 289 DLQTFNVSDNNLCGKIPTGGNLQRFDRTAYLHNSCLCGAPLPEC 332
[61][TOP]
>UniRef100_C5YXZ3 Putative uncharacterized protein Sb09g000440 n=1 Tax=Sorghum
bicolor RepID=C5YXZ3_SORBI
Length = 345
Score = 53.1 bits (126), Expect = 9e-06
Identities = 22/45 (48%), Positives = 30/45 (66%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
NL F+VSYN L G +P GG + + D ++Y H + LCGTP P C+
Sbjct: 301 NLHFFNVSYNRLCGGVPTGGNMARLDAYNYQHNKCLCGTPLPTCK 345
[62][TOP]
>UniRef100_C3VX44 Polygalacturonase-inhibiting protein 3 n=1 Tax=Brassica rapa subsp.
pekinensis RepID=C3VX44_BRARP
Length = 331
Score = 53.1 bits (126), Expect = 9e-06
Identities = 22/45 (48%), Positives = 32/45 (71%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNCQ 78
+LQ F+VSYN L G+IP GG+L +FD ++Y H + LC P +C+
Sbjct: 287 DLQTFNVSYNRLCGRIPQGGDLQRFDAYAYLHNKCLCDAPLQSCK 331
[63][TOP]
>UniRef100_B6V8Z6 Polygalacturonase-inhibiting protein n=1 Tax=Vaccinium corymbosum
RepID=B6V8Z6_VACCO
Length = 329
Score = 53.1 bits (126), Expect = 9e-06
Identities = 25/44 (56%), Positives = 28/44 (63%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNC 81
N Q +VSYN L GKIP GG+L F SYFH + LCG P P C
Sbjct: 286 NFQYLNVSYNRLCGKIPTGGKLQSFAATSYFHNKCLCGAPLPAC 329
[64][TOP]
>UniRef100_B6SN21 Polygalacturonase inhibitor n=1 Tax=Zea mays RepID=B6SN21_MAIZE
Length = 341
Score = 53.1 bits (126), Expect = 9e-06
Identities = 23/40 (57%), Positives = 28/40 (70%)
Frame = -2
Query: 212 NLQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTP 93
NLQ F VSYN L G +PPGG +G FD +S+ H + LCG P
Sbjct: 296 NLQLFKVSYNRLWGAVPPGGNMGSFDAYSFQHNRCLCGPP 335
[65][TOP]
>UniRef100_A9YBZ6 Polygalacturonase inhibitor protein 15 n=1 Tax=Brassica napus
RepID=A9YBZ6_BRANA
Length = 347
Score = 53.1 bits (126), Expect = 9e-06
Identities = 23/43 (53%), Positives = 30/43 (69%)
Frame = -2
Query: 209 LQPFHVSYNLLSGKIPPGGELGKFDKFSYFHYQNLCGTPPPNC 81
LQ F+VSYN L G+IP GG+L FD ++Y H + LCG P +C
Sbjct: 289 LQSFNVSYNRLCGRIPQGGDLQIFDAYAYLHNKCLCGAPLQSC 331