[UP]
[1][TOP]
>UniRef100_B7FIY1 Putative uncharacterized protein n=1 Tax=Medicago truncatula
RepID=B7FIY1_MEDTR
Length = 263
Score = 85.5 bits (210), Expect = 2e-15
Identities = 41/56 (73%), Positives = 41/56 (73%), Gaps = 11/56 (19%)
Frame = -3
Query: 415 APQPAPYGQPYGYPPAPPPAQGYPAT-----------GYPPAAYPPPGYPPSGYSR 281
APQPA YGQ YGYPPAPPPAQGYPAT GYPP AYPP GYPPSGYSR
Sbjct: 209 APQPA-YGQNYGYPPAPPPAQGYPATGYPSAAYPPQQGYPPTAYPPQGYPPSGYSR 263
[2][TOP]
>UniRef100_A9PCV7 Putative uncharacterized protein n=1 Tax=Populus trichocarpa
RepID=A9PCV7_POPTR
Length = 253
Score = 72.4 bits (176), Expect = 1e-11
Identities = 32/47 (68%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
Frame = -3
Query: 415 APQP--APYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 281
APQ PYGQPYGYPP P QGYP GYPP+ YPPP YPPSGY +
Sbjct: 209 APQTYGQPYGQPYGYPPQPH--QGYPVAGYPPSNYPPPAYPPSGYPK 253
[3][TOP]
>UniRef100_B9GKE8 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GKE8_POPTR
Length = 94
Score = 70.1 bits (170), Expect = 7e-11
Identities = 30/42 (71%), Positives = 31/42 (73%)
Frame = -3
Query: 406 PAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 281
P YGQPYGYPP AQGYPA GYPP AYPP YPPSGY +
Sbjct: 56 PQGYGQPYGYPPQ---AQGYPAAGYPPPAYPPSNYPPSGYPK 94
[4][TOP]
>UniRef100_A9PIT6 Putative uncharacterized protein n=1 Tax=Populus trichocarpa x
Populus deltoides RepID=A9PIT6_9ROSI
Length = 248
Score = 70.1 bits (170), Expect = 7e-11
Identities = 30/42 (71%), Positives = 31/42 (73%)
Frame = -3
Query: 406 PAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 281
P YGQPYGYPP AQGYPA GYPP AYPP YPPSGY +
Sbjct: 210 PQGYGQPYGYPPQ---AQGYPAAGYPPPAYPPSNYPPSGYPK 248
[5][TOP]
>UniRef100_C6SXX5 Putative uncharacterized protein n=1 Tax=Glycine max
RepID=C6SXX5_SOYBN
Length = 248
Score = 68.6 bits (166), Expect = 2e-10
Identities = 34/46 (73%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
Frame = -3
Query: 415 APQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 281
APQPA YGQP GYP A GYP TGYPPAAYPPPGYPPSGY +
Sbjct: 209 APQPA-YGQPAQGYP-----APGYPPTGYPPAAYPPPGYPPSGYPK 248
[6][TOP]
>UniRef100_A9RJ18 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens
RepID=A9RJ18_PHYPA
Length = 377
Score = 66.6 bits (161), Expect = 8e-10
Identities = 27/40 (67%), Positives = 29/40 (72%)
Frame = -3
Query: 400 PYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 281
P G P GYPPA P GYP +GYPP+ YPP GYPPSGY R
Sbjct: 230 PPGAPAGYPPAGYPPAGYPPSGYPPSGYPPSGYPPSGYPR 269
Score = 56.6 bits (135), Expect = 8e-07
Identities = 25/42 (59%), Positives = 26/42 (61%)
Frame = -3
Query: 412 PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 287
PQ P + YPP P GYP GYPPA YPP GYPPSGY
Sbjct: 218 PQGYPPQGGHAYPPGAPA--GYPPAGYPPAGYPPSGYPPSGY 257
[7][TOP]
>UniRef100_B9N0Q7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9N0Q7_POPTR
Length = 175
Score = 64.7 bits (156), Expect = 3e-09
Identities = 28/42 (66%), Positives = 28/42 (66%)
Frame = -3
Query: 412 PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 287
PQP Y P GYPP P QGYP GYPPA YPP YPPSGY
Sbjct: 32 PQPGAY-PPQGYPPQGYPPQGYPPQGYPPAGYPPGAYPPSGY 72
Score = 57.0 bits (136), Expect = 6e-07
Identities = 25/39 (64%), Positives = 27/39 (69%), Gaps = 2/39 (5%)
Frame = -3
Query: 397 YGQPYGYPPAPP--PAQGYPATGYPPAAYPPPGYPPSGY 287
+G P GYPP P P QGYP GYPP YPP GYPP+GY
Sbjct: 25 HGAP-GYPPQPGAYPPQGYPPQGYPPQGYPPQGYPPAGY 62
[8][TOP]
>UniRef100_A9P8F5 Putative uncharacterized protein n=1 Tax=Populus trichocarpa
RepID=A9P8F5_POPTR
Length = 189
Score = 64.7 bits (156), Expect = 3e-09
Identities = 28/42 (66%), Positives = 28/42 (66%)
Frame = -3
Query: 412 PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 287
PQP Y P GYPP P QGYP GYPPA YPP YPPSGY
Sbjct: 32 PQPGAY-PPQGYPPQGYPPQGYPPQGYPPAGYPPGAYPPSGY 72
Score = 57.0 bits (136), Expect = 6e-07
Identities = 25/39 (64%), Positives = 27/39 (69%), Gaps = 2/39 (5%)
Frame = -3
Query: 397 YGQPYGYPPAPP--PAQGYPATGYPPAAYPPPGYPPSGY 287
+G P GYPP P P QGYP GYPP YPP GYPP+GY
Sbjct: 25 HGAP-GYPPQPGAYPPQGYPPQGYPPQGYPPQGYPPAGY 62
[9][TOP]
>UniRef100_B9RDV3 Putative uncharacterized protein n=1 Tax=Ricinus communis
RepID=B9RDV3_RICCO
Length = 248
Score = 63.2 bits (152), Expect = 9e-09
Identities = 31/49 (63%), Positives = 32/49 (65%), Gaps = 5/49 (10%)
Frame = -3
Query: 412 PQPAPYGQP----YGYPPAPPPAQGYPATGYPPAAYPPPG-YPPSGYSR 281
P P P G P YG PP PP AQGYP GYPP YPPPG YPPSGY +
Sbjct: 201 PIPPPIGYPPQPAYGQPP-PPYAQGYPPAGYPPPQYPPPGAYPPSGYPK 248
[10][TOP]
>UniRef100_Q0D320 Rhodopsin (Fragment) n=1 Tax=Enoploteuthis higginsi
RepID=Q0D320_9MOLL
Length = 134
Score = 63.2 bits (152), Expect = 9e-09
Identities = 29/44 (65%), Positives = 29/44 (65%), Gaps = 2/44 (4%)
Frame = -3
Query: 415 APQPAPYGQPYGYPPA--PPPAQGYPATGYPPAAYPPPGYPPSG 290
A QPA Y P GYPP PPP QGYP GYPP YPP GYPP G
Sbjct: 80 AQQPA-YPPPQGYPPQGYPPPPQGYPPQGYPPQGYPPQGYPPQG 122
[11][TOP]
>UniRef100_Q0D316 Rhodopsin (Fragment) n=1 Tax=Megalocranchia fisheri
RepID=Q0D316_9MOLL
Length = 298
Score = 63.2 bits (152), Expect = 9e-09
Identities = 26/40 (65%), Positives = 26/40 (65%)
Frame = -3
Query: 409 QPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 290
QPA Y P GYPP P QGYP GYPP YPP GYPP G
Sbjct: 244 QPAGYPPPAGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQG 283
Score = 57.8 bits (138), Expect = 4e-07
Identities = 26/44 (59%), Positives = 26/44 (59%), Gaps = 1/44 (2%)
Frame = -3
Query: 418 PAPQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 290
PA P P G P GYPP P QGYP GYPP YPP G PP G
Sbjct: 245 PAGYPPPAGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGAPPQG 288
Score = 53.1 bits (126), Expect = 9e-06
Identities = 24/35 (68%), Positives = 24/35 (68%)
Frame = -3
Query: 391 QPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 287
QP GYPP PA GYP GYPP YPP GYPP GY
Sbjct: 244 QPAGYPP---PA-GYPPQGYPPQGYPPQGYPPQGY 274
[12][TOP]
>UniRef100_B9RCF3 Putative uncharacterized protein n=1 Tax=Ricinus communis
RepID=B9RCF3_RICCO
Length = 244
Score = 62.8 bits (151), Expect = 1e-08
Identities = 30/45 (66%), Positives = 32/45 (71%), Gaps = 1/45 (2%)
Frame = -3
Query: 412 PQPAPYGQPYGYPPAPPPAQGYPATGYPPAA-YPPPGYPPSGYSR 281
P A YGQPY AQGYPA+GYPP + YPPPGYPPSGYSR
Sbjct: 208 PPQAAYGQPY--------AQGYPASGYPPPSNYPPPGYPPSGYSR 244
[13][TOP]
>UniRef100_Q8H8G4 Putative uncharacterized protein OJ1126B12.17 n=1 Tax=Oryza sativa
Japonica Group RepID=Q8H8G4_ORYSJ
Length = 241
Score = 62.4 bits (150), Expect = 2e-08
Identities = 33/49 (67%), Positives = 33/49 (67%), Gaps = 8/49 (16%)
Frame = -3
Query: 412 PQPAPYGQPYG-YPPAPPPAQGYPATGYPPA------AYPPPG-YPPSG 290
PQ YGQPYG YPPAPP AQGYP YPPA AYPPPG YPP G
Sbjct: 177 PQQPAYGQPYGGYPPAPP-AQGYPPAAYPPAGYPQGGAYPPPGSYPPPG 224
[14][TOP]
>UniRef100_Q10SG5 Os03g0123600 protein n=1 Tax=Oryza sativa Japonica Group
RepID=Q10SG5_ORYSJ
Length = 274
Score = 62.4 bits (150), Expect = 2e-08
Identities = 33/49 (67%), Positives = 33/49 (67%), Gaps = 8/49 (16%)
Frame = -3
Query: 412 PQPAPYGQPYG-YPPAPPPAQGYPATGYPPA------AYPPPG-YPPSG 290
PQ YGQPYG YPPAPP AQGYP YPPA AYPPPG YPP G
Sbjct: 210 PQQPAYGQPYGGYPPAPP-AQGYPPAAYPPAGYPQGGAYPPPGSYPPPG 257
[15][TOP]
>UniRef100_B8ALY9 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
RepID=B8ALY9_ORYSI
Length = 274
Score = 62.4 bits (150), Expect = 2e-08
Identities = 33/49 (67%), Positives = 33/49 (67%), Gaps = 8/49 (16%)
Frame = -3
Query: 412 PQPAPYGQPYG-YPPAPPPAQGYPATGYPPA------AYPPPG-YPPSG 290
PQ YGQPYG YPPAPP AQGYP YPPA AYPPPG YPP G
Sbjct: 210 PQQPAYGQPYGGYPPAPP-AQGYPPAAYPPAGYPQGGAYPPPGSYPPPG 257
[16][TOP]
>UniRef100_A9NZ64 Putative uncharacterized protein n=1 Tax=Picea sitchensis
RepID=A9NZ64_PICSI
Length = 218
Score = 62.0 bits (149), Expect = 2e-08
Identities = 24/34 (70%), Positives = 26/34 (76%)
Frame = -3
Query: 388 PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 287
P GYPP+ P GYP +GYPPA YPP GYPPSGY
Sbjct: 33 PSGYPPSGYPPSGYPPSGYPPAGYPPSGYPPSGY 66
Score = 60.5 bits (145), Expect = 6e-08
Identities = 23/34 (67%), Positives = 25/34 (73%)
Frame = -3
Query: 388 PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 287
P GYPP+ P GYP GYPP+ YPP GYPPSGY
Sbjct: 38 PSGYPPSGYPPSGYPPAGYPPSGYPPSGYPPSGY 71
Score = 60.1 bits (144), Expect = 7e-08
Identities = 25/44 (56%), Positives = 28/44 (63%)
Frame = -3
Query: 418 PAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 287
P+ P P GYPPA P GYP +GYPP+ YP GYPPSGY
Sbjct: 38 PSGYPPSGYPPSGYPPAGYPPSGYPPSGYPPSGYPSSGYPPSGY 81
Score = 58.9 bits (141), Expect = 2e-07
Identities = 22/32 (68%), Positives = 25/32 (78%)
Frame = -3
Query: 382 GYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 287
GYPP+ P GYP +GYPP+ YPP GYPPSGY
Sbjct: 30 GYPPSGYPPSGYPPSGYPPSGYPPAGYPPSGY 61
Score = 58.5 bits (140), Expect = 2e-07
Identities = 24/44 (54%), Positives = 28/44 (63%)
Frame = -3
Query: 418 PAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 287
P+ P P GYPP+ P GYP +GYPP+ YPP GYP SGY
Sbjct: 33 PSGYPPSGYPPSGYPPSGYPPAGYPPSGYPPSGYPPSGYPSSGY 76
Score = 58.5 bits (140), Expect = 2e-07
Identities = 24/39 (61%), Positives = 28/39 (71%)
Frame = -3
Query: 406 PAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 290
PA Y P GYPP+ P GYP++GYPP+ YPP GYPP G
Sbjct: 53 PAGY-PPSGYPPSGYPPSGYPSSGYPPSGYPPAGYPPQG 90
Score = 57.8 bits (138), Expect = 4e-07
Identities = 23/44 (52%), Positives = 28/44 (63%)
Frame = -3
Query: 418 PAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 287
P+ P P GYPP+ P GYP +GYP + YPP GYPP+GY
Sbjct: 43 PSGYPPSGYPPAGYPPSGYPPSGYPPSGYPSSGYPPSGYPPAGY 86
Score = 54.7 bits (130), Expect = 3e-06
Identities = 24/46 (52%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
Frame = -3
Query: 418 PAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPP-GYPPSGYS 284
PA P P GYPP+ P+ GYP +GYPPA YPP GYPP ++
Sbjct: 53 PAGYPPSGYPPSGYPPSGYPSSGYPPSGYPPAGYPPQGGYPPPAHN 98
[17][TOP]
>UniRef100_A9NRB0 Putative uncharacterized protein n=1 Tax=Picea sitchensis
RepID=A9NRB0_PICSI
Length = 208
Score = 62.0 bits (149), Expect = 2e-08
Identities = 26/38 (68%), Positives = 28/38 (73%), Gaps = 1/38 (2%)
Frame = -3
Query: 397 YGQ-PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 287
+GQ P GYPP+ P GYP GYPPA YPP GYPPSGY
Sbjct: 24 HGQSPSGYPPSGYPPSGYPPAGYPPAGYPPAGYPPSGY 61
Score = 60.1 bits (144), Expect = 7e-08
Identities = 23/34 (67%), Positives = 25/34 (73%)
Frame = -3
Query: 388 PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 287
P GYPP+ P GYP GYPPA YPP GYPP+GY
Sbjct: 33 PSGYPPSGYPPAGYPPAGYPPAGYPPSGYPPAGY 66
Score = 58.2 bits (139), Expect = 3e-07
Identities = 24/43 (55%), Positives = 26/43 (60%)
Frame = -3
Query: 418 PAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 290
P+ P P GYPPA P GYP GYPP+ YPP GYPP G
Sbjct: 28 PSGYPPSGYPPSGYPPAGYPPAGYPPAGYPPSGYPPAGYPPQG 70
[18][TOP]
>UniRef100_P09241 Rhodopsin n=1 Tax=Enteroctopus dofleini RepID=OPSD_ENTDO
Length = 455
Score = 61.2 bits (147), Expect = 3e-08
Identities = 28/44 (63%), Positives = 28/44 (63%), Gaps = 3/44 (6%)
Frame = -3
Query: 412 PQPAPYGQP-YGYPP--APPPAQGYPATGYPPAAYPPPGYPPSG 290
P P P G P GYPP A PP QGYP GYPP YPP GYPP G
Sbjct: 389 PPPPPQGYPPQGYPPQGAYPPPQGYPPQGYPPQGYPPQGYPPQG 432
[19][TOP]
>UniRef100_Q9LF59 Glycine/proline-rich protein n=1 Tax=Arabidopsis thaliana
RepID=Q9LF59_ARATH
Length = 173
Score = 60.8 bits (146), Expect = 4e-08
Identities = 28/45 (62%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
Frame = -3
Query: 418 PAPQPAPYGQPYGYPP-APPPAQGYPATGYPPAAYPPPGYPPSGY 287
P P P P P+GYPP A PP GYP GYPPA YPP GYP GY
Sbjct: 44 PYPPPPP---PHGYPPVAYPPHGGYPPAGYPPAGYPPAGYPAHGY 85
Score = 56.6 bits (135), Expect = 8e-07
Identities = 24/38 (63%), Positives = 25/38 (65%), Gaps = 1/38 (2%)
Frame = -3
Query: 397 YGQPYGYPPAPPPAQGYPATGYPP-AAYPPPGYPPSGY 287
YG Y YPP PPP GYP YPP YPP GYPP+GY
Sbjct: 39 YGSSYPYPPPPPP-HGYPPVAYPPHGGYPPAGYPPAGY 75
[20][TOP]
>UniRef100_Q0WWS8 Glycine/proline-rich protein n=1 Tax=Arabidopsis thaliana
RepID=Q0WWS8_ARATH
Length = 173
Score = 60.8 bits (146), Expect = 4e-08
Identities = 28/45 (62%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
Frame = -3
Query: 418 PAPQPAPYGQPYGYPP-APPPAQGYPATGYPPAAYPPPGYPPSGY 287
P P P P P+GYPP A PP GYP GYPPA YPP GYP GY
Sbjct: 44 PYPPPPP---PHGYPPVAYPPHGGYPPAGYPPAGYPPAGYPAHGY 85
Score = 56.6 bits (135), Expect = 8e-07
Identities = 24/38 (63%), Positives = 25/38 (65%), Gaps = 1/38 (2%)
Frame = -3
Query: 397 YGQPYGYPPAPPPAQGYPATGYPP-AAYPPPGYPPSGY 287
YG Y YPP PPP GYP YPP YPP GYPP+GY
Sbjct: 39 YGSSYPYPPPPPP-HGYPPVAYPPHGGYPPAGYPPAGY 75
[21][TOP]
>UniRef100_Q0D313 Rhodopsin (Fragment) n=1 Tax=Illex coindetii RepID=Q0D313_9MOLL
Length = 286
Score = 60.5 bits (145), Expect = 6e-08
Identities = 27/42 (64%), Positives = 27/42 (64%)
Frame = -3
Query: 412 PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 287
PQP P P GYPP P QGYP GYPP YPP GYPP GY
Sbjct: 230 PQPPP---PQGYPPPP---QGYPPQGYPPQGYPPQGYPPQGY 265
Score = 53.9 bits (128), Expect = 5e-06
Identities = 26/44 (59%), Positives = 26/44 (59%), Gaps = 1/44 (2%)
Frame = -3
Query: 418 PAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPP-GYPPSG 290
P PQ P P GYPP P QGYP GYPP YPPP G PP G
Sbjct: 233 PPPQGYP-PPPQGYPPQGYPPQGYPPQGYPPQGYPPPQGAPPQG 275
[22][TOP]
>UniRef100_Q0D321 Rhodopsin (Fragment) n=1 Tax=Abraliopsis pacificus
RepID=Q0D321_9MOLL
Length = 299
Score = 60.1 bits (144), Expect = 7e-08
Identities = 28/43 (65%), Positives = 28/43 (65%), Gaps = 1/43 (2%)
Frame = -3
Query: 415 APQPAPYGQPYGYPPAP-PPAQGYPATGYPPAAYPPPGYPPSG 290
A QPA Y P GYPP PP QGYP GYPP YPP GYPP G
Sbjct: 246 AQQPA-YPPPQGYPPQGYPPPQGYPPQGYPPQGYPPQGYPPQG 287
[23][TOP]
>UniRef100_Q0D319 Rhodopsin (Fragment) n=1 Tax=Octopoteuthis nielseni
RepID=Q0D319_9MOLL
Length = 130
Score = 60.1 bits (144), Expect = 7e-08
Identities = 26/42 (61%), Positives = 26/42 (61%), Gaps = 1/42 (2%)
Frame = -3
Query: 409 QPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 287
Q P G P GYPP P QGYP GYPP YPP GYPP GY
Sbjct: 81 QAPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGY 122
Score = 54.7 bits (130), Expect = 3e-06
Identities = 24/39 (61%), Positives = 24/39 (61%)
Frame = -3
Query: 412 PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPP 296
PQ P P GYPP P QGYP GYPP YPP GYPP
Sbjct: 89 PQGYP---PQGYPPQGYPPQGYPPQGYPPQGYPPQGYPP 124
[24][TOP]
>UniRef100_Q6QE83 Rhodopsin (Fragment) n=1 Tax=Sthenoteuthis oualaniensis
RepID=Q6QE83_9MOLL
Length = 295
Score = 59.7 bits (143), Expect = 1e-07
Identities = 26/46 (56%), Positives = 28/46 (60%), Gaps = 2/46 (4%)
Frame = -3
Query: 418 PAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPP--GYPPSGY 287
P P P Y P GYPP P QGYP GYPP YPPP G PP+G+
Sbjct: 237 PPPPPQGYPPPQGYPPQGYPPQGYPPQGYPPQGYPPPPQGPPPAGW 282
[25][TOP]
>UniRef100_Q3BDP2 Rhodopsin (Fragment) n=1 Tax=Sepioteuthis australis
RepID=Q3BDP2_9MOLL
Length = 294
Score = 59.7 bits (143), Expect = 1e-07
Identities = 27/41 (65%), Positives = 27/41 (65%)
Frame = -3
Query: 409 QPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 287
Q A Y P GYPP PP QGYP GYPP YPP GYPP GY
Sbjct: 246 QQAAY-PPQGYPPPPP--QGYPPQGYPPQGYPPQGYPPQGY 283
Score = 54.7 bits (130), Expect = 3e-06
Identities = 25/42 (59%), Positives = 25/42 (59%), Gaps = 1/42 (2%)
Frame = -3
Query: 412 PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPP-GYPPSG 290
PQ P P GYPP P QGYP GYPP YPPP G PP G
Sbjct: 252 PQGYPPPPPQGYPPQGYPPQGYPPQGYPPQGYPPPQGPPPQG 293
[26][TOP]
>UniRef100_Q3BDP1 Rhodopsin (Fragment) n=1 Tax=Sepioteuthis lessoniana
RepID=Q3BDP1_SEPLE
Length = 288
Score = 59.7 bits (143), Expect = 1e-07
Identities = 27/41 (65%), Positives = 27/41 (65%)
Frame = -3
Query: 409 QPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 287
Q A Y P GYPP PP QGYP GYPP YPP GYPP GY
Sbjct: 247 QQAAY-PPQGYPPPPP--QGYPPQGYPPQGYPPQGYPPQGY 284
[27][TOP]
>UniRef100_Q0D323 Rhodopsin (Fragment) n=1 Tax=Architeuthis sp. JMS-2004
RepID=Q0D323_9MOLL
Length = 137
Score = 59.7 bits (143), Expect = 1e-07
Identities = 26/42 (61%), Positives = 26/42 (61%), Gaps = 1/42 (2%)
Frame = -3
Query: 412 PQPAPYGQPYGYPPAP-PPAQGYPATGYPPAAYPPPGYPPSG 290
P PA Y P GYPP PP QGYP GYPP YPP G PP G
Sbjct: 86 PPPAGYPPPQGYPPQGYPPPQGYPPQGYPPQGYPPQGAPPQG 127
[28][TOP]
>UniRef100_Q0D318 Rhodopsin (Fragment) n=1 Tax=Bathyteuthis abyssicola
RepID=Q0D318_9MOLL
Length = 170
Score = 59.7 bits (143), Expect = 1e-07
Identities = 28/44 (63%), Positives = 28/44 (63%), Gaps = 2/44 (4%)
Frame = -3
Query: 415 APQPAPYGQPYGYPPA--PPPAQGYPATGYPPAAYPPPGYPPSG 290
A QPA P GYPP PPP QGYP GYPP YPP GYPP G
Sbjct: 113 AAQPAY--PPQGYPPQGYPPPPQGYPPQGYPPQGYPPQGYPPQG 154
[29][TOP]
>UniRef100_B4YS99 Rhodopsin (Fragment) n=1 Tax=Afrololigo mercatoris
RepID=B4YS99_9MOLL
Length = 303
Score = 59.7 bits (143), Expect = 1e-07
Identities = 27/42 (64%), Positives = 28/42 (66%), Gaps = 3/42 (7%)
Frame = -3
Query: 409 QPAPYGQPYGYPPA---PPPAQGYPATGYPPAAYPPPGYPPS 293
QPA Y P GYPP PPP QGYP GYPP YPP GYPP+
Sbjct: 247 QPA-YPPPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPPA 287
[30][TOP]
>UniRef100_C4R4X2 Protein involved in positive regulation of both 1,3-beta-glucan
synthesis and the Pkc1p-MAPK pathway n=1 Tax=Pichia
pastoris GS115 RepID=C4R4X2_PICPG
Length = 1338
Score = 59.7 bits (143), Expect = 1e-07
Identities = 26/42 (61%), Positives = 27/42 (64%)
Frame = -3
Query: 412 PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 287
PQ P P GYPP P QGYP GYPP YPP GYPPSG+
Sbjct: 999 PQGYP---PQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPSGF 1037
Score = 57.0 bits (136), Expect = 6e-07
Identities = 22/32 (68%), Positives = 22/32 (68%)
Frame = -3
Query: 382 GYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 287
GYPP P QGYP GYPP YPP GYPP GY
Sbjct: 996 GYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGY 1027
Score = 56.6 bits (135), Expect = 8e-07
Identities = 22/34 (64%), Positives = 23/34 (67%)
Frame = -3
Query: 388 PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 287
P GYP P+QGYP GYPP YPP GYPP GY
Sbjct: 984 PKGYPTEGYPSQGYPPQGYPPQGYPPQGYPPQGY 1017
Score = 55.8 bits (133), Expect = 1e-06
Identities = 24/42 (57%), Positives = 25/42 (59%)
Frame = -3
Query: 412 PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 287
PQ P P GYPP P QGYP GYPP YPP G+PP Y
Sbjct: 1004 PQGYP---PQGYPPQGYPPQGYPPQGYPPQGYPPSGFPPQSY 1042
Score = 55.5 bits (132), Expect = 2e-06
Identities = 24/40 (60%), Positives = 25/40 (62%), Gaps = 1/40 (2%)
Frame = -3
Query: 403 APYGQPY-GYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 287
+P G P GYP P QGYP GYPP YPP GYPP GY
Sbjct: 983 SPKGYPTEGYPSQGYPPQGYPPQGYPPQGYPPQGYPPQGY 1022
[31][TOP]
>UniRef100_B4N6T9 GK24096 n=1 Tax=Drosophila willistoni RepID=B4N6T9_DROWI
Length = 536
Score = 59.3 bits (142), Expect = 1e-07
Identities = 28/46 (60%), Positives = 29/46 (63%), Gaps = 4/46 (8%)
Frame = -3
Query: 418 PAPQPAPYGQP---YGYPPAPPPAQGY-PATGYPPAAYPPPGYPPS 293
P PQ Y P YGYPP PPP QGY PA GYPP AY PP PP+
Sbjct: 28 PPPQYEGYAPPPPQYGYPPQPPPGQGYPPAAGYPPQAYAPPQPPPN 73
[32][TOP]
>UniRef100_Q3BDN9 Rhodopsin (Fragment) n=1 Tax=Loliolus sp. JMS-2004
RepID=Q3BDN9_9MOLL
Length = 297
Score = 58.9 bits (141), Expect = 2e-07
Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 3/43 (6%)
Frame = -3
Query: 409 QPAPYGQPYGYPPA---PPPAQGYPATGYPPAAYPPPGYPPSG 290
Q A Y P GYPP PPP QGYP GYPP YPP GYPP G
Sbjct: 246 QQAAY-PPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPPQG 287
Score = 55.5 bits (132), Expect = 2e-06
Identities = 26/44 (59%), Positives = 26/44 (59%), Gaps = 3/44 (6%)
Frame = -3
Query: 412 PQPAPYGQPYGYPPAPP---PAQGYPATGYPPAAYPPPGYPPSG 290
PQ P P GYPP PP P QGYP GYPP YPP G PP G
Sbjct: 252 PQGYP---PQGYPPPPPQGYPPQGYPPQGYPPQGYPPQGAPPQG 292
[33][TOP]
>UniRef100_Q0D314 Rhodopsin (Fragment) n=1 Tax=Cranchia scabra RepID=Q0D314_9MOLL
Length = 278
Score = 58.9 bits (141), Expect = 2e-07
Identities = 23/34 (67%), Positives = 23/34 (67%)
Frame = -3
Query: 388 PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 287
P GYPP P QGYP GYPP YPP GYPP GY
Sbjct: 238 PAGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGY 271
Score = 57.8 bits (138), Expect = 4e-07
Identities = 25/39 (64%), Positives = 25/39 (64%)
Frame = -3
Query: 406 PAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 290
PA Y P GYPP P QGYP GYPP YPP GYPP G
Sbjct: 238 PAGY-PPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQG 275
Score = 53.9 bits (128), Expect = 5e-06
Identities = 21/30 (70%), Positives = 21/30 (70%)
Frame = -3
Query: 376 PPAPPPAQGYPATGYPPAAYPPPGYPPSGY 287
PPA P QGYP GYPP YPP GYPP GY
Sbjct: 237 PPAGYPPQGYPPQGYPPQGYPPQGYPPQGY 266
Score = 53.1 bits (126), Expect = 9e-06
Identities = 23/41 (56%), Positives = 23/41 (56%)
Frame = -3
Query: 418 PAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPP 296
PA P P GYPP P QGYP GYPP YPP G PP
Sbjct: 238 PAGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGAPP 278
[34][TOP]
>UniRef100_A0JMY8 Plscr2 protein n=1 Tax=Xenopus laevis RepID=A0JMY8_XENLA
Length = 354
Score = 58.5 bits (140), Expect = 2e-07
Identities = 25/42 (59%), Positives = 26/42 (61%)
Frame = -3
Query: 412 PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 287
P P PYGY PA P GY TGYPPA Y P GYPP+GY
Sbjct: 26 PGYPPPQNPYGYQPAGYPPAGYQPTGYPPAGYQPAGYPPAGY 67
Score = 58.5 bits (140), Expect = 2e-07
Identities = 28/45 (62%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
Frame = -3
Query: 418 PAPQPAPYG-QPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 287
P PQ PYG QP GYPPA GYP GY PA YPP GY P+GY
Sbjct: 29 PPPQN-PYGYQPAGYPPAGYQPTGYPPAGYQPAGYPPAGYQPAGY 72
Score = 56.6 bits (135), Expect = 8e-07
Identities = 25/44 (56%), Positives = 26/44 (59%)
Frame = -3
Query: 418 PAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 287
PA P QP GYPPA GYP GY PA YPP GY P+GY
Sbjct: 39 PAGYPPAGYQPTGYPPAGYQPAGYPPAGYQPAGYPPAGYQPAGY 82
[35][TOP]
>UniRef100_A9NZ96 Putative uncharacterized protein n=1 Tax=Picea sitchensis
RepID=A9NZ96_PICSI
Length = 257
Score = 58.5 bits (140), Expect = 2e-07
Identities = 27/46 (58%), Positives = 30/46 (65%)
Frame = -3
Query: 418 PAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 281
P QPA Y QPYGYP Q YPA GYPP+ YP GYPP+GY +
Sbjct: 218 PYGQPA-YPQPYGYP-----TQNYPAQGYPPSGYPSSGYPPAGYKK 257
[36][TOP]
>UniRef100_A2DBY2 XYPPX repeat family protein n=1 Tax=Trichomonas vaginalis G3
RepID=A2DBY2_TRIVA
Length = 383
Score = 58.5 bits (140), Expect = 2e-07
Identities = 27/44 (61%), Positives = 28/44 (63%), Gaps = 2/44 (4%)
Frame = -3
Query: 412 PQPAPYGQPYGYPPAP-PPAQGYPATGYPP-AAYPPPGYPPSGY 287
P PAPY GYPP PP GYP GYPP AYPP GYPP G+
Sbjct: 142 PAPAPYPPQGGYPPQGYPPQGGYPPQGYPPQGAYPPQGYPPQGF 185
[37][TOP]
>UniRef100_Q6QE84 Rhodopsin (Fragment) n=1 Tax=Loligo forbesi RepID=Q6QE84_LOLFO
Length = 305
Score = 57.8 bits (138), Expect = 4e-07
Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 3/41 (7%)
Frame = -3
Query: 409 QPAPYGQPYGYPPA---PPPAQGYPATGYPPAAYPPPGYPP 296
Q P P GYPP PPP QGYP GYPP YPP GYPP
Sbjct: 245 QQQPAYPPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPP 285
[38][TOP]
>UniRef100_Q3BDP0 Rhodopsin (Fragment) n=1 Tax=Photololigo sp. JMS-2004
RepID=Q3BDP0_9MOLL
Length = 305
Score = 57.8 bits (138), Expect = 4e-07
Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 3/41 (7%)
Frame = -3
Query: 409 QPAPYGQPYGYPPA---PPPAQGYPATGYPPAAYPPPGYPP 296
Q P P GYPP PPP QGYP GYPP YPP GYPP
Sbjct: 245 QQQPAYPPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPP 285
[39][TOP]
>UniRef100_Q17094 Rhodopsin (Fragment) n=1 Tax=Alloteuthis subulata RepID=OPSD_LOLSU
Length = 439
Score = 57.8 bits (138), Expect = 4e-07
Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 3/41 (7%)
Frame = -3
Query: 409 QPAPYGQPYGYPPA---PPPAQGYPATGYPPAAYPPPGYPP 296
Q P P GYPP PPP QGYP GYPP YPP GYPP
Sbjct: 378 QQQPAYPPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPP 418
[40][TOP]
>UniRef100_P24603 Rhodopsin n=1 Tax=Loligo forbesi RepID=OPSD_LOLFO
Length = 452
Score = 57.8 bits (138), Expect = 4e-07
Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 3/41 (7%)
Frame = -3
Query: 409 QPAPYGQPYGYPPA---PPPAQGYPATGYPPAAYPPPGYPP 296
Q P P GYPP PPP QGYP GYPP YPP GYPP
Sbjct: 385 QQQPAYPPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPP 425
[41][TOP]
>UniRef100_UPI0000D57386 PREDICTED: similar to phospholipid scramblase 1, putative n=1
Tax=Tribolium castaneum RepID=UPI0000D57386
Length = 214
Score = 57.4 bits (137), Expect = 5e-07
Identities = 29/58 (50%), Positives = 30/58 (51%), Gaps = 14/58 (24%)
Frame = -3
Query: 418 PAPQPAPY---------GQPYGYPP----APPPAQGYPATGYPPAAYPPPG-YPPSGY 287
P P P PY GQ YG PP PPP G P GYPP YPPPG YPP G+
Sbjct: 11 PGPYPTPYNGQYPPMPPGQGYGTPPPPGYGPPPGYGPPPQGYPPGQYPPPGQYPPPGH 68
[42][TOP]
>UniRef100_UPI00003BE83A hypothetical protein DEHA0G23474g n=1 Tax=Debaryomyces hansenii
CBS767 RepID=UPI00003BE83A
Length = 440
Score = 57.4 bits (137), Expect = 5e-07
Identities = 27/48 (56%), Positives = 27/48 (56%), Gaps = 4/48 (8%)
Frame = -3
Query: 418 PAPQPAPYGQPYGYPPAP----PPAQGYPATGYPPAAYPPPGYPPSGY 287
P P P P G YG PP PP QGYP GYPP YPP GY P GY
Sbjct: 15 PPPGP-PNGYQYGPPPGAQGQYPPPQGYPPQGYPPQGYPPQGYAPQGY 61
Score = 56.6 bits (135), Expect = 8e-07
Identities = 25/46 (54%), Positives = 26/46 (56%), Gaps = 3/46 (6%)
Frame = -3
Query: 412 PQPAPYGQ---PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYS 284
P P GQ P GYPP P QGYP GY P YPP GY P GY+
Sbjct: 27 PPPGAQGQYPPPQGYPPQGYPPQGYPPQGYAPQGYPPQGYAPQGYA 72
Score = 53.9 bits (128), Expect = 5e-06
Identities = 26/45 (57%), Positives = 27/45 (60%), Gaps = 3/45 (6%)
Frame = -3
Query: 409 QPAPYGQPYGYPPAPPP-AQGY--PATGYPPAAYPPPGYPPSGYS 284
Q P G P GY PPP AQG P GYPP YPP GYPP GY+
Sbjct: 13 QAPPPGPPNGYQYGPPPGAQGQYPPPQGYPPQGYPPQGYPPQGYA 57
Score = 53.1 bits (126), Expect = 9e-06
Identities = 24/46 (52%), Positives = 25/46 (54%)
Frame = -3
Query: 418 PAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 281
P PQ P P GYPP P QGY GYPP Y P GY P GY +
Sbjct: 36 PPPQGYP---PQGYPPQGYPPQGYAPQGYPPQGYAPQGYAPQGYQQ 78
[43][TOP]
>UniRef100_Q3BDP7 Rhodopsin (Fragment) n=1 Tax=Bathyteuthis berryi RepID=Q3BDP7_9MOLL
Length = 267
Score = 57.4 bits (137), Expect = 5e-07
Identities = 27/42 (64%), Positives = 27/42 (64%), Gaps = 2/42 (4%)
Frame = -3
Query: 415 APQPAPYGQPYGYPPA--PPPAQGYPATGYPPAAYPPPGYPP 296
A QPA P GYPP PPP QGYP GYPP YPP GYPP
Sbjct: 228 AAQPAY--PPQGYPPQGYPPPPQGYPPQGYPPQGYPPQGYPP 267
[44][TOP]
>UniRef100_Q3BDP4 Rhodopsin (Fragment) n=1 Tax=Ommastrephes bartramii
RepID=Q3BDP4_9MOLL
Length = 296
Score = 57.4 bits (137), Expect = 5e-07
Identities = 24/38 (63%), Positives = 24/38 (63%), Gaps = 3/38 (7%)
Frame = -3
Query: 391 QPYGYPPAPP---PAQGYPATGYPPAAYPPPGYPPSGY 287
Q YPP PP P QGYP GYPP YPP GYPP GY
Sbjct: 237 QQAAYPPPPPQGYPPQGYPPQGYPPQGYPPQGYPPQGY 274
Score = 55.1 bits (131), Expect = 2e-06
Identities = 26/44 (59%), Positives = 26/44 (59%), Gaps = 3/44 (6%)
Frame = -3
Query: 412 PQPAPYGQP-YGYPPAPPPAQGYPATGYPPAAYPPP--GYPPSG 290
P P P G P GYPP P QGYP GYPP YPPP G PP G
Sbjct: 242 PPPPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPPPQGPPPQG 285
[45][TOP]
>UniRef100_Q0D324 Rhodopsin (Fragment) n=1 Tax=Onychoteuthis sp. B3-JMS-2004
RepID=Q0D324_9MOLL
Length = 303
Score = 57.4 bits (137), Expect = 5e-07
Identities = 25/42 (59%), Positives = 25/42 (59%)
Frame = -3
Query: 415 APQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 290
A Q A P GYPP P QGYP GYPP YPP GYPP G
Sbjct: 246 AQQAAYPPPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQG 287
Score = 55.8 bits (133), Expect = 1e-06
Identities = 25/43 (58%), Positives = 25/43 (58%)
Frame = -3
Query: 418 PAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSG 290
P PQ P P GYPP P QGYP GYPP YPP G PP G
Sbjct: 253 PPPQGYP---PQGYPPQGYPPQGYPPQGYPPQGYPPQGAPPQG 292
Score = 55.5 bits (132), Expect = 2e-06
Identities = 24/41 (58%), Positives = 24/41 (58%), Gaps = 2/41 (4%)
Frame = -3
Query: 403 APYGQPYGYPPAPP--PAQGYPATGYPPAAYPPPGYPPSGY 287
A Q YPP P P QGYP GYPP YPP GYPP GY
Sbjct: 243 AQQAQQAAYPPPPQGYPPQGYPPQGYPPQGYPPQGYPPQGY 283
[46][TOP]
>UniRef100_Q6BH13 Metacaspase-1 n=1 Tax=Debaryomyces hansenii RepID=MCA1_DEBHA
Length = 440
Score = 57.4 bits (137), Expect = 5e-07
Identities = 27/48 (56%), Positives = 27/48 (56%), Gaps = 4/48 (8%)
Frame = -3
Query: 418 PAPQPAPYGQPYGYPPAP----PPAQGYPATGYPPAAYPPPGYPPSGY 287
P P P P G YG PP PP QGYP GYPP YPP GY P GY
Sbjct: 15 PPPGP-PNGYQYGPPPGAQGQYPPPQGYPPQGYPPQGYPPQGYAPQGY 61
Score = 56.6 bits (135), Expect = 8e-07
Identities = 25/46 (54%), Positives = 26/46 (56%), Gaps = 3/46 (6%)
Frame = -3
Query: 412 PQPAPYGQ---PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYS 284
P P GQ P GYPP P QGYP GY P YPP GY P GY+
Sbjct: 27 PPPGAQGQYPPPQGYPPQGYPPQGYPPQGYAPQGYPPQGYAPQGYA 72
Score = 53.9 bits (128), Expect = 5e-06
Identities = 26/45 (57%), Positives = 27/45 (60%), Gaps = 3/45 (6%)
Frame = -3
Query: 409 QPAPYGQPYGYPPAPPP-AQGY--PATGYPPAAYPPPGYPPSGYS 284
Q P G P GY PPP AQG P GYPP YPP GYPP GY+
Sbjct: 13 QAPPPGPPNGYQYGPPPGAQGQYPPPQGYPPQGYPPQGYPPQGYA 57
Score = 53.1 bits (126), Expect = 9e-06
Identities = 24/46 (52%), Positives = 25/46 (54%)
Frame = -3
Query: 418 PAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 281
P PQ P P GYPP P QGY GYPP Y P GY P GY +
Sbjct: 36 PPPQGYP---PQGYPPQGYPPQGYAPQGYPPQGYAPQGYAPQGYQQ 78
[47][TOP]
>UniRef100_C0IN06 Proline-rich family protein n=1 Tax=Cicer arietinum
RepID=C0IN06_CICAR
Length = 186
Score = 57.0 bits (136), Expect = 6e-07
Identities = 25/43 (58%), Positives = 28/43 (65%), Gaps = 3/43 (6%)
Frame = -3
Query: 406 PAPYGQPYGYPPAP--PPAQGYPATGYPPA-AYPPPGYPPSGY 287
P Y +GYPP PP QGYP +GYPP YPP GYPP+GY
Sbjct: 37 PGAYPPQHGYPPQQGYPPQQGYPPSGYPPQQGYPPQGYPPAGY 79
[48][TOP]
>UniRef100_Q3BDN7 Rhodopsin (Fragment) n=1 Tax=Heteroteuthis hawaiiensis
RepID=Q3BDN7_9MOLL
Length = 294
Score = 57.0 bits (136), Expect = 6e-07
Identities = 29/45 (64%), Positives = 29/45 (64%), Gaps = 3/45 (6%)
Frame = -3
Query: 415 APQPAPYGQPYGYPPA--PPPAQGYPATGYPP-AAYPPPGYPPSG 290
A QPA P GYPP PPP QGYP GYPP AYPP GYPP G
Sbjct: 236 AQQPAY--PPQGYPPQGYPPPPQGYPPQGYPPQGAYPPQGYPPQG 278
[49][TOP]
>UniRef100_Q0D322 Rhodopsin (Fragment) n=1 Tax=Histioteuthis oceanica
RepID=Q0D322_9MOLL
Length = 299
Score = 57.0 bits (136), Expect = 6e-07
Identities = 25/43 (58%), Positives = 25/43 (58%), Gaps = 2/43 (4%)
Frame = -3
Query: 412 PQPAPYGQPYGYPPA--PPPAQGYPATGYPPAAYPPPGYPPSG 290
P P P GYPP PPP QGYP GYPP YPP G PP G
Sbjct: 246 PPPQQGYPPQGYPPQGYPPPPQGYPPQGYPPQGYPPQGAPPQG 288
[50][TOP]
>UniRef100_B9SDA8 Glycine-rich protein A3, putative n=1 Tax=Ricinus communis
RepID=B9SDA8_RICCO
Length = 177
Score = 56.6 bits (135), Expect = 8e-07
Identities = 26/50 (52%), Positives = 31/50 (62%), Gaps = 4/50 (8%)
Frame = -3
Query: 418 PAPQPAPYGQ---PYGYPPAPPPAQGYPATGYP-PAAYPPPGYPPSGYSR 281
PA P+PYG P YPP+ PP + Y TG+P P YPP YPP+GY R
Sbjct: 54 PAGYPSPYGYSSPPSAYPPSYPPQKPYGPTGFPSPGGYPPVAYPPAGYPR 103
[51][TOP]
>UniRef100_A9P8I3 Predicted protein n=1 Tax=Populus trichocarpa RepID=A9P8I3_POPTR
Length = 125
Score = 55.8 bits (133), Expect = 1e-06
Identities = 25/44 (56%), Positives = 26/44 (59%), Gaps = 3/44 (6%)
Frame = -3
Query: 406 PAPYGQPY---GYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYS 284
P+ Y PY GYPP PP GYP T P YPPPG PP GYS
Sbjct: 13 PSGYSPPYPPPGYPPTTPPYGGYPPTTPPYGGYPPPGAPPPGYS 56
[52][TOP]
>UniRef100_Q3BDP3 Rhodopsin (Fragment) n=1 Tax=Lolliguncula brevis RepID=Q3BDP3_9MOLL
Length = 296
Score = 55.8 bits (133), Expect = 1e-06
Identities = 28/44 (63%), Positives = 28/44 (63%), Gaps = 4/44 (9%)
Frame = -3
Query: 415 APQPAPYGQPYGYPPA---PPPAQGYPATGYPPA-AYPPPGYPP 296
A QPA Y P GYPP PPP QGYP GYPP YPP GYPP
Sbjct: 245 AAQPA-YPPPQGYPPQGYPPPPPQGYPPQGYPPPQGYPPQGYPP 287
[53][TOP]
>UniRef100_A0C5H2 Chromosome undetermined scaffold_15, whole genome shotgun sequence
n=1 Tax=Paramecium tetraurelia RepID=A0C5H2_PARTE
Length = 198
Score = 55.8 bits (133), Expect = 1e-06
Identities = 29/58 (50%), Positives = 29/58 (50%), Gaps = 19/58 (32%)
Frame = -3
Query: 412 PQPAPYGQPY----------------GYPPAP--PPAQGYPAT-GYPPAAYPPPGYPP 296
P P P G PY GYPP P PP GYP T GYPPA YPP GYPP
Sbjct: 39 PPPPPAGYPYPPTPGYPPPVGGYPQQGYPPTPGYPPTPGYPPTPGYPPAGYPPAGYPP 96
[54][TOP]
>UniRef100_B9I6F5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9I6F5_POPTR
Length = 192
Score = 55.5 bits (132), Expect = 2e-06
Identities = 25/33 (75%), Positives = 25/33 (75%), Gaps = 2/33 (6%)
Frame = -3
Query: 379 YPP-APPPAQGYPATGYPPAAYPPP-GYPPSGY 287
YPP AP P GYP GYPPA YPPP GYPPSGY
Sbjct: 29 YPPSAPYPPHGYPQQGYPPAGYPPPGGYPPSGY 61
Score = 53.9 bits (128), Expect = 5e-06
Identities = 26/44 (59%), Positives = 29/44 (65%), Gaps = 2/44 (4%)
Frame = -3
Query: 412 PQPAPYGQPYGYPPAPPPAQGYPATG-YPPAAYPPPG-YPPSGY 287
P APY P+GYP P GYP G YPP+ YPPPG YPP+GY
Sbjct: 30 PPSAPY-PPHGYPQQGYPPAGYPPPGGYPPSGYPPPGGYPPAGY 72
Score = 53.9 bits (128), Expect = 5e-06
Identities = 28/45 (62%), Positives = 30/45 (66%), Gaps = 3/45 (6%)
Frame = -3
Query: 415 APQPAPYGQPY-GYPPAP-PPAQGYPATGYPP-AAYPPPGYPPSG 290
AP P P+G P GYPPA PP GYP +GYPP YPP GYPP G
Sbjct: 33 APYP-PHGYPQQGYPPAGYPPPGGYPPSGYPPPGGYPPAGYPPPG 76
[55][TOP]
>UniRef100_Q0D326 Rhodopsin (Fragment) n=2 Tax=Euprymna RepID=Q0D326_9MOLL
Length = 298
Score = 55.5 bits (132), Expect = 2e-06
Identities = 28/43 (65%), Positives = 28/43 (65%), Gaps = 3/43 (6%)
Frame = -3
Query: 415 APQPAPYGQPYGYPPA--PPPAQGYPATGYPP-AAYPPPGYPP 296
A Q A Y P GYPP PPP QGYP GYPP AYPP GYPP
Sbjct: 246 AQQQAAY-PPQGYPPQGYPPPPQGYPPQGYPPQGAYPPQGYPP 287
[56][TOP]
>UniRef100_B8Q2W3 Opsin n=1 Tax=Euprymna scolopes RepID=B8Q2W3_9MOLL
Length = 448
Score = 55.5 bits (132), Expect = 2e-06
Identities = 28/43 (65%), Positives = 28/43 (65%), Gaps = 3/43 (6%)
Frame = -3
Query: 415 APQPAPYGQPYGYPPA--PPPAQGYPATGYPP-AAYPPPGYPP 296
A Q A Y P GYPP PPP QGYP GYPP AYPP GYPP
Sbjct: 386 AQQQAAY-PPQGYPPQGYPPPPQGYPPQGYPPQGAYPPQGYPP 427
[57][TOP]
>UniRef100_B8Q2W2 Opsin n=1 Tax=Euprymna scolopes RepID=B8Q2W2_9MOLL
Length = 448
Score = 55.5 bits (132), Expect = 2e-06
Identities = 28/43 (65%), Positives = 28/43 (65%), Gaps = 3/43 (6%)
Frame = -3
Query: 415 APQPAPYGQPYGYPPA--PPPAQGYPATGYPP-AAYPPPGYPP 296
A Q A Y P GYPP PPP QGYP GYPP AYPP GYPP
Sbjct: 386 AQQQAAY-PPQGYPPQGYPPPPQGYPPQGYPPQGAYPPQGYPP 427
[58][TOP]
>UniRef100_A5PLE2 UPF0467 protein C5orf32 homolog n=1 Tax=Danio rerio
RepID=CE032_DANRE
Length = 118
Score = 55.5 bits (132), Expect = 2e-06
Identities = 24/42 (57%), Positives = 24/42 (57%)
Frame = -3
Query: 412 PQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 287
P PAP GYP P QGYPA GYPP YP GYP GY
Sbjct: 12 PGPAPGYPAQGYPAQGYPTQGYPAQGYPPQGYPAQGYPAQGY 53
[59][TOP]
>UniRef100_C6T3K1 Putative uncharacterized protein n=1 Tax=Glycine max
RepID=C6T3K1_SOYBN
Length = 183
Score = 55.1 bits (131), Expect = 2e-06
Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 2/44 (4%)
Frame = -3
Query: 412 PQPAPYGQPYGYPPAP-PPAQGYPATGYPPAAYP-PPGYPPSGY 287
P PY P+GYPP+ PP GYP T YPP AYP P YP SGY
Sbjct: 24 PSAPPYPPPHGYPPSGYPPPGGYPPTAYPPPAYPPPGVYPHSGY 67
[60][TOP]
>UniRef100_A7PSK5 Chromosome chr6 scaffold_28, whole genome shotgun sequence n=1
Tax=Vitis vinifera RepID=A7PSK5_VITVI
Length = 191
Score = 55.1 bits (131), Expect = 2e-06
Identities = 28/48 (58%), Positives = 30/48 (62%), Gaps = 8/48 (16%)
Frame = -3
Query: 406 PAPYGQPYGYPPAP-PPAQGYPATGYPP------AAYPPP-GYPPSGY 287
P+ Y P GYPP+ PP GYP GYPP A YPPP GYPPSGY
Sbjct: 54 PSGYPPPGGYPPSGYPPPGGYPPAGYPPPGGYPPAPYPPPGGYPPSGY 101
[61][TOP]
>UniRef100_P31356 Rhodopsin n=1 Tax=Todarodes pacificus RepID=OPSD_TODPA
Length = 448
Score = 55.1 bits (131), Expect = 2e-06
Identities = 25/38 (65%), Positives = 25/38 (65%), Gaps = 3/38 (7%)
Frame = -3
Query: 391 QPYGYPP---APPPAQGYPATGYPPAAYPPPGYPPSGY 287
Q YPP APPP QGYP GYPP YPP GYPP GY
Sbjct: 384 QQAAYPPQGYAPPP-QGYPPQGYPPQGYPPQGYPPQGY 420
[62][TOP]
>UniRef100_Q3BDN8 Rhodopsin (Fragment) n=1 Tax=Rossia pacifica RepID=Q3BDN8_ROSPA
Length = 305
Score = 54.7 bits (130), Expect = 3e-06
Identities = 28/43 (65%), Positives = 28/43 (65%), Gaps = 3/43 (6%)
Frame = -3
Query: 415 APQPAPYGQPYGYPPA--PPPAQGYPATGYPP-AAYPPPGYPP 296
A QPA P GYPP PPP QGYP GYPP AYPP GYPP
Sbjct: 246 AQQPAY--PPQGYPPQGYPPPPQGYPPQGYPPQGAYPPQGYPP 286
[63][TOP]
>UniRef100_B4YS71 Rhodopsin (Fragment) n=1 Tax=Alloteuthis africana
RepID=B4YS71_9MOLL
Length = 303
Score = 54.7 bits (130), Expect = 3e-06
Identities = 27/42 (64%), Positives = 27/42 (64%), Gaps = 4/42 (9%)
Frame = -3
Query: 409 QPAPYGQPYGYPPA---PPPAQGYPATGYPPA-AYPPPGYPP 296
QPA Y P GYPP PPP QGYP GYPP YPP GYPP
Sbjct: 247 QPA-YPPPQGYPPQGYPPPPPQGYPPQGYPPPQGYPPQGYPP 287
[64][TOP]
>UniRef100_A2XNE8 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
RepID=A2XNE8_ORYSI
Length = 185
Score = 54.3 bits (129), Expect = 4e-06
Identities = 28/51 (54%), Positives = 28/51 (54%), Gaps = 11/51 (21%)
Frame = -3
Query: 406 PAPYGQPYGYPPAPP----PAQGYPATGYPPAAYP------PPG-YPPSGY 287
P Y P GYP APP PA GYP YPP YP PPG YPPSGY
Sbjct: 39 PGQYPTPGGYPSAPPGQYPPADGYPGAQYPPGGYPPSQGGYPPGAYPPSGY 89
[65][TOP]
>UniRef100_A0CRV7 Chromosome undetermined scaffold_25, whole genome shotgun sequence
n=1 Tax=Paramecium tetraurelia RepID=A0CRV7_PARTE
Length = 177
Score = 54.3 bits (129), Expect = 4e-06
Identities = 30/59 (50%), Positives = 30/59 (50%), Gaps = 18/59 (30%)
Frame = -3
Query: 418 PAPQPAPYGQP-------------YGYPPAP---PPAQGYPATGYPPA-AYPP-PGYPP 296
P P P YGQP Y YPP P PP GYP GYPPA YPP PGYPP
Sbjct: 17 PPPPPPAYGQPPYPQPGYQPPPTGYPYPPTPGYPPPVGGYPQPGYPPAPGYPPTPGYPP 75
[66][TOP]
>UniRef100_B1HT22 Putative uncharacterized protein n=1 Tax=Lysinibacillus sphaericus
C3-41 RepID=B1HT22_LYSSC
Length = 153
Score = 53.9 bits (128), Expect = 5e-06
Identities = 24/44 (54%), Positives = 24/44 (54%), Gaps = 3/44 (6%)
Frame = -3
Query: 418 PAPQPAPYGQPYG---YPPAPPPAQGYPATGYPPAAYPPPGYPP 296
P P P PY PY YPP P P Q YP YPP YPP YPP
Sbjct: 71 PPPYPPPYPTPYPPQPYPPRPYPPQPYPPRPYPPRPYPPQPYPP 114
[67][TOP]
>UniRef100_Q84TC1 Putative uncharacterized protein OJ1754_E06.10 n=1 Tax=Oryza sativa
Japonica Group RepID=Q84TC1_ORYSJ
Length = 185
Score = 53.9 bits (128), Expect = 5e-06
Identities = 28/51 (54%), Positives = 29/51 (56%), Gaps = 11/51 (21%)
Frame = -3
Query: 406 PAPYGQPYGYPPAPP----PAQGYPATGYPPAAYP------PPG-YPPSGY 287
P Y P GYP APP PA GYP YPP+ YP PPG YPPSGY
Sbjct: 39 PGQYPTPGGYPSAPPGQYPPAGGYPGAQYPPSGYPPSQGGYPPGAYPPSGY 89
Score = 53.1 bits (126), Expect = 9e-06
Identities = 26/52 (50%), Positives = 29/52 (55%), Gaps = 8/52 (15%)
Frame = -3
Query: 418 PAPQPAPYGQPYGYPPAPPPAQGYPAT--GYPPAAYPP------PGYPPSGY 287
P+ P Y GYP A P GYP + GYPP AYPP PGYPP+GY
Sbjct: 49 PSAPPGQYPPAGGYPGAQYPPSGYPPSQGGYPPGAYPPSGYPQQPGYPPAGY 100
[68][TOP]
>UniRef100_Q10BG2 Os03g0819300 protein n=1 Tax=Oryza sativa Japonica Group
RepID=Q10BG2_ORYSJ
Length = 180
Score = 53.9 bits (128), Expect = 5e-06
Identities = 28/51 (54%), Positives = 29/51 (56%), Gaps = 11/51 (21%)
Frame = -3
Query: 406 PAPYGQPYGYPPAPP----PAQGYPATGYPPAAYP------PPG-YPPSGY 287
P Y P GYP APP PA GYP YPP+ YP PPG YPPSGY
Sbjct: 39 PGQYPTPGGYPSAPPGQYPPAGGYPGAQYPPSGYPPSQGGYPPGAYPPSGY 89
Score = 53.1 bits (126), Expect = 9e-06
Identities = 26/52 (50%), Positives = 29/52 (55%), Gaps = 8/52 (15%)
Frame = -3
Query: 418 PAPQPAPYGQPYGYPPAPPPAQGYPAT--GYPPAAYPP------PGYPPSGY 287
P+ P Y GYP A P GYP + GYPP AYPP PGYPP+GY
Sbjct: 49 PSAPPGQYPPAGGYPGAQYPPSGYPPSQGGYPPGAYPPSGYPQQPGYPPAGY 100
[69][TOP]
>UniRef100_B9N0V9 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9N0V9_POPTR
Length = 143
Score = 53.9 bits (128), Expect = 5e-06
Identities = 27/51 (52%), Positives = 28/51 (54%), Gaps = 7/51 (13%)
Frame = -3
Query: 418 PAPQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGY-------PPSGY 287
P P P P+ GYPP PPP GYP GYPP PPPGY PP GY
Sbjct: 41 PPPPPPPHE---GYPPPPPPPPGYP--GYPPPGPPPPGYPGYPPPGPPRGY 86
[70][TOP]
>UniRef100_B9I8M8 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9I8M8_POPTR
Length = 81
Score = 53.9 bits (128), Expect = 5e-06
Identities = 29/45 (64%), Positives = 29/45 (64%)
Frame = -3
Query: 415 APQPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGYSR 281
APQ A YGQPYGYPP PP Q GYPPA P YPP GYSR
Sbjct: 44 APQQA-YGQPYGYPP-PPQTQ-----GYPPAYPQPHAYPPHGYSR 81
[71][TOP]
>UniRef100_B6SHN0 Adhesive/proline-rich protein n=1 Tax=Zea mays RepID=B6SHN0_MAIZE
Length = 93
Score = 53.9 bits (128), Expect = 5e-06
Identities = 23/33 (69%), Positives = 23/33 (69%), Gaps = 2/33 (6%)
Frame = -3
Query: 388 PYGYPPA--PPPAQGYPATGYPPAAYPPPGYPP 296
P GYPPA PPPAQGYP GYP YP GYPP
Sbjct: 26 PAGYPPAGYPPPAQGYPPQGYPQQGYPQQGYPP 58
[72][TOP]
>UniRef100_A9NLR5 Putative uncharacterized protein n=1 Tax=Picea sitchensis
RepID=A9NLR5_PICSI
Length = 95
Score = 53.9 bits (128), Expect = 5e-06
Identities = 21/30 (70%), Positives = 21/30 (70%)
Frame = -3
Query: 376 PPAPPPAQGYPATGYPPAAYPPPGYPPSGY 287
P PP QGYP GYP AYPPPGYPP GY
Sbjct: 10 PVGVPPPQGYPPEGYPKDAYPPPGYPPQGY 39
[73][TOP]
>UniRef100_Q3BDP5 Rhodopsin (Fragment) n=1 Tax=Joubiniteuthis sp. JMS-2004
RepID=Q3BDP5_9MOLL
Length = 283
Score = 53.9 bits (128), Expect = 5e-06
Identities = 28/47 (59%), Positives = 28/47 (59%), Gaps = 5/47 (10%)
Frame = -3
Query: 415 APQPAPYGQPY----GYPPAP-PPAQGYPATGYPPAAYPPPGYPPSG 290
A QPA Q Y GYPP PPAQGYP GYPP YPP G PP G
Sbjct: 228 AQQPAYPQQGYPPAQGYPPQGYPPAQGYPPQGYPPQGYPPQGAPPXG 274
[74][TOP]
>UniRef100_Q0D312 Rhodopsin (Fragment) n=1 Tax=Todaropsis eblanae RepID=Q0D312_9MOLL
Length = 300
Score = 53.9 bits (128), Expect = 5e-06
Identities = 23/39 (58%), Positives = 23/39 (58%), Gaps = 4/39 (10%)
Frame = -3
Query: 391 QPYGYPPA----PPPAQGYPATGYPPAAYPPPGYPPSGY 287
Q YPP PPP QGYP GYPP YP GYPP GY
Sbjct: 244 QQAAYPPQGYAQPPPPQGYPPQGYPPQGYPQQGYPPQGY 282
Score = 53.1 bits (126), Expect = 9e-06
Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 1/41 (2%)
Frame = -3
Query: 409 QPAPYGQPYGYPPAPPPAQGYPATGYPPAAYPPP-GYPPSG 290
QP P P GYPP P QGYP GYPP YPPP G PP G
Sbjct: 255 QPPP---PQGYPPQGYPPQGYPQQGYPPQGYPPPQGAPPQG 292
[75][TOP]
>UniRef100_B4YS88 Rhodopsin (Fragment) n=1 Tax=Alloteuthis media RepID=B4YS88_9MOLL
Length = 309
Score = 53.9 bits (128), Expect = 5e-06
Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 2/43 (4%)
Frame = -3
Query: 409 QPAPYGQPYGYPPA--PPPAQGYPATGYPPAAYPPPGYPPSGY 287
QPA Y P GYPP PPP QGYP GYPP P GYPP GY
Sbjct: 247 QPA-YPPPQGYPPQGYPPPPQGYPPQGYPP----PQGYPPQGY 284
[76][TOP]
>UniRef100_A7S7Y1 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7S7Y1_NEMVE
Length = 349
Score = 53.9 bits (128), Expect = 5e-06
Identities = 26/53 (49%), Positives = 27/53 (50%), Gaps = 9/53 (16%)
Frame = -3
Query: 418 PAPQPAPYGQPYGYPPAPPPAQGYPATGY---------PPAAYPPPGYPPSGY 287
P P + Y P GYPP P Q YPA Y PP AYP PGYPP GY
Sbjct: 160 PHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQPPPQAYPQPGYPPQGY 212
[77][TOP]
>UniRef100_Q32L53 Glutamate [NMDA] receptor-associated protein 1 n=1 Tax=Bos taurus
RepID=GRINA_BOVIN
Length = 366
Score = 53.9 bits (128), Expect = 5e-06
Identities = 29/53 (54%), Positives = 31/53 (58%), Gaps = 12/53 (22%)
Frame = -3
Query: 409 QPAPYGQPYGYP--PAPPPAQGYPATGYPPAAYP----PPG------YPPSGY 287
QP+PYGQP GYP P+P P GYP YPP YP PPG YPP GY
Sbjct: 43 QPSPYGQP-GYPQGPSPYPQGGYPQGPYPPGGYPQGPYPPGGYPQGPYPPGGY 94
[78][TOP]
>UniRef100_UPI0001739304 unknown protein n=1 Tax=Arabidopsis thaliana RepID=UPI0001739304
Length = 124
Score = 53.5 bits (127), Expect = 7e-06
Identities = 28/49 (57%), Positives = 29/49 (59%), Gaps = 4/49 (8%)
Frame = -3
Query: 415 APQPAPYGQPYGYPPA--PPPAQGYPATGYPPAAYPPPGYPP--SGYSR 281
AP P Y GYPPA PPPA GYP YP A YPP GYPP GY +
Sbjct: 12 APPPQGYPPKEGYPPAGYPPPA-GYPPPQYPQAGYPPAGYPPPQQGYGQ 59
[79][TOP]
>UniRef100_Q9M2X4 Putative uncharacterized protein T16K5.190 n=1 Tax=Arabidopsis
thaliana RepID=Q9M2X4_ARATH
Length = 651
Score = 53.5 bits (127), Expect = 7e-06
Identities = 28/49 (57%), Positives = 29/49 (59%), Gaps = 4/49 (8%)
Frame = -3
Query: 415 APQPAPYGQPYGYPPA--PPPAQGYPATGYPPAAYPPPGYPP--SGYSR 281
AP P Y GYPPA PPPA GYP YP A YPP GYPP GY +
Sbjct: 539 APPPQGYPPKEGYPPAGYPPPA-GYPPPQYPQAGYPPAGYPPPQQGYGQ 586
[80][TOP]
>UniRef100_Q9C4Z8 Putative uncharacterized protein F27M3_5 n=1 Tax=Arabidopsis
thaliana RepID=Q9C4Z8_ARATH
Length = 176
Score = 53.5 bits (127), Expect = 7e-06
Identities = 27/48 (56%), Positives = 27/48 (56%), Gaps = 5/48 (10%)
Frame = -3
Query: 418 PAPQPAPYGQPYGYPPA--PPPAQGYPATGYPP--AAYPPPGYP-PSG 290
P P Y P GYPP PPP GYP YPP AYPP GYP PSG
Sbjct: 30 PPPPQGAYPPPGGYPPQGYPPPPHGYPPAAYPPPPGAYPPAGYPGPSG 77
[81][TOP]
>UniRef100_Q8LEP5 Putative glycine and proline-rich protein n=1 Tax=Arabidopsis
thaliana RepID=Q8LEP5_ARATH
Length = 176
Score = 53.5 bits (127), Expect = 7e-06
Identities = 27/48 (56%), Positives = 27/48 (56%), Gaps = 5/48 (10%)
Frame = -3
Query: 418 PAPQPAPYGQPYGYPPA--PPPAQGYPATGYPP--AAYPPPGYP-PSG 290
P P Y P GYPP PPP GYP YPP AYPP GYP PSG
Sbjct: 30 PPPPQGAYPPPGGYPPQGYPPPPHGYPPAAYPPPPGAYPPAGYPGPSG 77
[82][TOP]
>UniRef100_C6SWT5 Putative uncharacterized protein n=1 Tax=Glycine max
RepID=C6SWT5_SOYBN
Length = 170
Score = 53.5 bits (127), Expect = 7e-06
Identities = 24/44 (54%), Positives = 26/44 (59%), Gaps = 1/44 (2%)
Frame = -3
Query: 412 PQPAPYGQPYGYPPAPPPAQGYPA-TGYPPAAYPPPGYPPSGYS 284
P P Y GYPPA P GYP GYPPA YPP GYP S ++
Sbjct: 41 PPPGAYPPQQGYPPAGYPPAGYPPHQGYPPAGYPPAGYPGSSHA 84
[83][TOP]
>UniRef100_B8AMB4 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
RepID=B8AMB4_ORYSI
Length = 180
Score = 53.5 bits (127), Expect = 7e-06
Identities = 28/51 (54%), Positives = 28/51 (54%), Gaps = 11/51 (21%)
Frame = -3
Query: 406 PAPYGQPYGYPPAPP----PAQGYPATGYPPAAYP------PPG-YPPSGY 287
P Y P GYP APP PA GYP YPP YP PPG YPPSGY
Sbjct: 39 PGQYPTPGGYPSAPPGQYPPAGGYPGAQYPPGGYPPSQGGYPPGAYPPSGY 89
[84][TOP]
>UniRef100_Q6QE96 Rhodopsin (Fragment) n=1 Tax=Octopus bimaculoides
RepID=Q6QE96_OCTBM
Length = 294
Score = 53.5 bits (127), Expect = 7e-06
Identities = 28/45 (62%), Positives = 28/45 (62%), Gaps = 4/45 (8%)
Frame = -3
Query: 409 QPAPYGQP--YGYPPAPPPAQG-YPATGYPP-AAYPPPGYPPSGY 287
Q A Y QP GYPP P QG YP GYPP AYPP GYPP GY
Sbjct: 243 QQAAYQQPPPQGYPPQGYPPQGAYPPQGYPPQGAYPPQGYPPQGY 287
[85][TOP]
>UniRef100_B5DPT7 GA23811 n=1 Tax=Drosophila pseudoobscura pseudoobscura
RepID=B5DPT7_DROPS
Length = 561
Score = 53.5 bits (127), Expect = 7e-06
Identities = 24/45 (53%), Positives = 25/45 (55%), Gaps = 2/45 (4%)
Frame = -3
Query: 415 APQPAPYGQ--PYGYPPAPPPAQGYPATGYPPAAYPPPGYPPSGY 287
A PA + P GYPP P QGYP GYPP YP GYP GY
Sbjct: 7 AAPPAGFSSAPPAGYPPQEYPPQGYPQQGYPPQGYPAQGYPQQGY 51
[86][TOP]
>UniRef100_A2EVN2 XYPPX repeat family protein n=1 Tax=Trichomonas vaginalis G3
RepID=A2EVN2_TRIVA
Length = 231
Score = 53.5 bits (127), Expect = 7e-06
Identities = 29/57 (50%), Positives = 31/57 (54%), Gaps = 14/57 (24%)
Frame = -3
Query: 415 APQPAPYG-QPYGYPPA--------PP----PAQGYPATGYPPAAYPPPGYPP-SGY 287
AP AP+ +P GYPP PP P QGYP GYPP YP PGYPP GY
Sbjct: 124 APNEAPFQPRPQGYPPMGGYPQAGYPPQGGYPPQGYPQAGYPPQGYPQPGYPPQQGY 180
[87][TOP]
>UniRef100_C0PCD9 Putative uncharacterized protein n=1 Tax=Zea mays
RepID=C0PCD9_MAIZE
Length = 239
Score = 53.1 bits (126), Expect = 9e-06
Identities = 31/58 (53%), Positives = 32/58 (55%), Gaps = 16/58 (27%)
Frame = -3
Query: 415 APQPAPYGQPYGYPPAPP-------PAQGYPATGYPP-AAYPPP--------GYPPSG 290
APQPA YGQPYG P+PP P QGYP GY AYPPP GYPP G
Sbjct: 91 APQPA-YGQPYGGYPSPPGQGYPPPPGQGYPPAGYSQGGAYPPPAQGYPHGGGYPPPG 147
[88][TOP]
>UniRef100_C0HFT3 Putative uncharacterized protein n=1 Tax=Zea mays
RepID=C0HFT3_MAIZE
Length = 357
Score = 53.1 bits (126), Expect = 9e-06
Identities = 31/58 (53%), Positives = 32/58 (55%), Gaps = 16/58 (27%)
Frame = -3
Query: 415 APQPAPYGQPYGYPPAPP-------PAQGYPATGYPP-AAYPPP--------GYPPSG 290
APQPA YGQPYG P+PP P QGYP GY AYPPP GYPP G
Sbjct: 209 APQPA-YGQPYGGYPSPPGQGYPPPPGQGYPPAGYSQGGAYPPPAQGYPHGGGYPPPG 265
[89][TOP]
>UniRef100_Q1DWE3 Putative uncharacterized protein n=1 Tax=Coccidioides immitis
RepID=Q1DWE3_COCIM
Length = 442
Score = 53.1 bits (126), Expect = 9e-06
Identities = 25/44 (56%), Positives = 25/44 (56%), Gaps = 2/44 (4%)
Frame = -3
Query: 412 PQPAPYGQPYGYPPAPPPAQGYPATGY--PPAAYPPPGYPPSGY 287
P PA Y QP PP PP G P GY PP YPP GYPP GY
Sbjct: 16 PNPA-YAQPGQQPPQQPPPHGAPPQGYYPPPQGYPPQGYPPQGY 58
[90][TOP]
>UniRef100_C5PBW6 XYPPX repeat family protein n=1 Tax=Coccidioides posadasii C735
delta SOWgp RepID=C5PBW6_COCP7
Length = 442
Score = 53.1 bits (126), Expect = 9e-06
Identities = 25/44 (56%), Positives = 25/44 (56%), Gaps = 2/44 (4%)
Frame = -3
Query: 412 PQPAPYGQPYGYPPAPPPAQGYPATGY--PPAAYPPPGYPPSGY 287
P PA Y QP PP PP G P GY PP YPP GYPP GY
Sbjct: 16 PNPA-YAQPGQQPPQQPPPHGAPPQGYYPPPQGYPPQGYPPQGY 58