[UP]
[1][TOP]
>UniRef100_C6TM29 Putative uncharacterized protein n=1 Tax=Glycine max
RepID=C6TM29_SOYBN
Length = 363
Score = 63.9 bits (154), Expect = 5e-09
Identities = 29/45 (64%), Positives = 35/45 (77%)
Frame = +3
Query: 114 MAILKSYSTVCITGTGFPVCPSNATNNKTTRNSCWKPAQAALKPN 248
MA LKS +C GT FPVCPSN TNN+ +R+S W+PAQAA+KPN
Sbjct: 1 MATLKS---LCFRGTAFPVCPSNVTNNRNSRSSYWRPAQAAVKPN 42
[2][TOP]
>UniRef100_C6TG34 Putative uncharacterized protein n=1 Tax=Glycine max
RepID=C6TG34_SOYBN
Length = 363
Score = 60.8 bits (146), Expect = 4e-08
Identities = 28/45 (62%), Positives = 33/45 (73%)
Frame = +3
Query: 114 MAILKSYSTVCITGTGFPVCPSNATNNKTTRNSCWKPAQAALKPN 248
MA LKS VC G+ FPVCPSN TN + TR+SCW+P QAA+K N
Sbjct: 1 MATLKS---VCFRGSTFPVCPSNFTNTRNTRSSCWRPTQAAVKSN 42